IPL1 1fffQRfB@f  1Ҵfff0fff%f&$ZfYˁtu1ɠ$<0t6<t%< t< t & G 1҉)׉։>6f[fXRead error No bootable partition PUWEVfd1200P` hWEVOo ` ` ` f)Ȏ؎ffggggggffgffIP)( RvUWVS}1۾5] sP}C~j5j55 =puB E1҉9}. ` EruB9| =h`Sh =`t,ShhSbt h`uPaP5$PtRtR5555hh [%0t-S u j 9 hSH=9Åt(5hU(WVSj EPMҍvI tAt9Ȇ%=t$=t= t=thr\ҁ t!1tf E%EP5aP5$Ph}huhuEP* }}t GuuhuW }uh |}t )؉߉=5jWEP!ujSh:uW }j]S jWSE܃E܃Pjh/uWc }܉=5 5 ơ ơ Ɓ5555T5`)BAu<IBAuh`'Sh`)AhhSEPWhD+h5V PEPe[^_UVSE] uhuVS D3e[^ UVSMu A t t-uzA tހ t܀auCu cuDudu@guπhuPuru suvuAut(1 @At t uKt#t hahtte[^gf f"f f ؎Ўff0 (؎Ў f"f Ȏ؎ЎfUffӁpjjjpp 3 SjpfffUVWQfu} MY_^]Qـ1ؠYUSVW]M uUu}?$<0t!`CPUR`MM]j e[^_UVSu  hHHd;`tp0Sh``V Йyt`e[^UWVSCt <(u;u@Zz:u> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] .configtotal=0x%x entry point=0x%x No keyboard found Keyboard found bad disklabel Error: D:0x%x C:%d H:%d S:%d %s Unknown device @O7|/-\ 08TP>`   SP>|U`V/mnt><>@@<@T 08SP>`   SP>|U`@@<@TU SP>` V80I @ ,OZ/ASP>SP>SP>A RP>SP>SP>%tEQP>QP>SP>WHK,!QP>QP>SP>R!QP>QP>SP>;W!QP>QP>SP>U~!QP>QP>SP>ܝz!QP>QP>SP>DV!QP>QP>SP>A!QP>QP>SP> o !QP>QP>SP>*&!QP>QP>SP>s%S9!QP>QP>SP>-65!QP>QP>SP>7p!QP>QP>SP>Y8!QP>QP>SP>b iD!QP>QP>SP>NN CmARP>SP>SP>qI!QP>QP>SP>R6!QP>QP>SP>/r!QP>QP>SP>"7!QP>QP>SP>p-!QP>QP>SP>u+!QP>QP>SP>Nyf!QP>QP>SP>-!QP>QP>SP>Y!QP>QP>SP>vj!QP>QP>SP> Jd!QP>QP>SP> b!QP>QP>SP> ):!QP>QP>SP> !QP>QP>SP> !QP>QP>SP> ۉ/!QP>QP>SP> ?!QP>QP>SP> _!QP>QP>SP> m|!QP>QP>SP> DF>!QP>QP>SP> n"Z!QP>QP>SP> 7]!QP>QP>SP> U!QP>QP>SP> aQP>SP> a!QP>QP>SP> c!QP>QP>SP> %s!QP>QP>SP> qu!QP>QP>SP> '4G!QP>QP>SP> j/^!QP>QP>SP> }8!QP>QP>SP> G!QP>QP>SP> FM.!QP>QP>SP>  *!QP>QP>SP> GH!QP>QP>SP> ʽB!QP>QP>SP> ] G!QP>QP>SP> .!QP>QP>SP> B!QP>QP>SP> E&!!QP>QP>SP> |!QP>QP>SP> k&!QP>QP>SP> !QP>QP>SP>FmS!QP>QP>SP>F",:!QP>QP>SP>F!QP>QP>SP>F|I!QP>QP>SP>Fyz!QP>QP>SP>FA2p!QP>QP>SP>F !QP>QP>SP>F 8!QP>QP>SP>FUJ!QP>QP>SP>F h!QP>QP>SP>FH!QP>QP>SP>F|/!QP>QP>SP>FOVm!QP>QP>SP>F^m$!QP>QP>SP>FJ!QP>QP>SP>Fbb!QP>QP>SP>FXYd!QP>QP>SP>F(!QP>QP>SP>F\E!QP>QP>SP>Ft!QP>QP>SP>F@>!QP>QP>SP>thE!QP>QP>SP>tL<!QP>QP>SP>t !QP>QP>SP>tt !QP>QP>SP>t j!QP>QP>SP>txC!QP>QP>SP>t(j/!QP>QP>SP>tU!QP>QP>SP>t%T[j!QP>QP>SP>tX(3!QP>QP>SP>t2W!QP>QP>SP>tG$!QP>QP>SP>tC!QP>QP>SP>ts|[[!QP>QP>SP>t\!QP>QP>SP>tz3!QP>QP>SP>t3Zf!QP>QP>SP>twX!QP>QP>SP>tM~!QP>QP>SP>t !O!QP>QP>SP>t ef!QP>QP>SP>u=-!QP>QP>SP>vpp<!QP>QP>SP>voy!QP>QP>SP>vͲw!QP>QP>SP>vZ7!QP>QP>SP>vg!QP>QP>SP>vǃ !QP>QP>SP>v/}:!QP>QP>SP>v ׃\!QP>QP>SP>v^!QP>QP>SP>vo!QP>QP>SP>v#9!QP>QP>SP>v~_!QP>QP>SP>vd :!QP>QP>SP>v1!QP>QP>SP>vE-#!QP>QP>SP>v=!QP>QP>SP>v !QP>QP>SP>v !QP>QP>SP>vp!QP>QP>SP>v*_!QP>QP>SP>v4l2!QP>QP>SP>wj4!QP>QP>SP>ww;!RP>RP>SP>AQ!RP>RP>SP>pjh!RP>RP>SP>wu!!RP>RP>SP>X&)!RP>RP>SP>$f!RP>RP>SP>p!RP>RP>SP>i2J!RP>RP>SP>`!RP>RP>SP>kk-!RP>RP>SP>ث!RP>RP>SP>,Û !RP>RP>SP>>8L!RP>RP>SP>}{!RP>RP>SP>F`-!RP>RP>SP>n!RP>RP>SP>T:X!RP>RP>SP>3 !RP>RP>SP>=%!RP>RP>SP>xsq!RP>RP>SP>gk!RP>RP>SP>_!RP>RP>SP>Enyu!RP>RP>SP>EϬ!RP>RP>SP>W*S!RP>RP>SP>W{`}!RP>RP>SP>WF!RP>RP>SP>WͽC!RP>RP>SP>W ]!RP>RP>SP>W` O!RP>RP>SP>W6cx!RP>RP>SP>Wq<!RP>RP>SP>W/ !RP>RP>SP>W`!RP>RP>SP>WkK9!RP>RP>SP>W6J!RP>RP>SP>WG!RP>RP>SP>WFB*!RP>RP>SP>Wh[!RP>RP>SP>W'(\!RP>RP>SP>WkBW!RP>RP>SP>Wn!RP>RP>SP>WSi!RP>RP>SP>W/z#!RP>RP>SP>Wj!RP>RP>SP>ZE2|!RP>RP>SP>+^0*!RP>RP>SP>+dB!RP>RP>SP>+<"!RP>RP>SP>+'fU1!RP>RP>SP>+`:4!RP>RP>SP>+B!RP>RP>SP>+zF!RP>RP>SP>+ )!RP>RP>SP>+/!RP>RP>SP>+7!RP>RP>SP>+'!RP>RP>SP>+uL:!RP>RP>SP>+]!RP>RP>SP>+~w5!RP>RP>SP>+V !RP>RP>SP>+U!RP>RP>SP>+sq!RP>RP>SP>+)*!RP>RP>SP>+6!RP>RP>SP>+4$V!RP>RP>SP>+lt!RP>RP>SP>]ԣ~!RP>RP>SP>zf!RP>RP>SP> YO!RP>RP>SP>#[!RP>RP>SP>G,W!RP>RP>SP>>!RP>RP>SP>?D!RP>RP>SP>u${!RP>RP>SP>-G)!RP>RP>SP>Z!RP>RP>SP> _{T%!RP>RP>SP> l!RP>RP>SP> U5l}!RP>RP>SP> V!RP>RP>SP>&uH !RP>RP>SP>  !RP>RP>SP> K\^SP>SP>SP>ttyv0I!RP>RP>SP>)BD!RP>RP>SP>:7BD!RP>RP>SP>+qBD!RP>RP>SP>o\c!RP>RP>SP>!RP>RP>SP>)Fu!RP>RP>SP>'3Vm!RP>RP>SP>-j!RP>RP>SP>!RP>RP>SP> !RP>RP>SP>zg!!RP>RP>SP>wg!RP>RP>SP>x7b !RP>RP>SP>־ !RP>RP>SP>SRP>SP>нF\!RP>RP>SP>X/{!RP>RP>SP>h?!RP>RP>SP>X!RP>RP>SP>-o?!RP>RP>SP> ;!RP>RP>SP> HD!RP>RP>SP> E+!RP>RP>SP> le`!RP>RP>SP> V0!RP>RP>SP> !RP>RP>SP> 7!RP>RP>SP> P!RP>RP>SP> .#!RP>RP>SP> ;>mT!RP>RP>SP> v!RP>RP>SP>ҐOM!RP>RP>SP>u҃ !RP>RP>SP> !RP>RP>SP>@N1!RP>RP>SP>i\# !RP>RP>SP>H_!RP>RP>SP>f !RP>RP>SP>N !RP>RP>SP>!RP>RP>SP>r:%6!RP>RP>SP>t,!RP>RP>SP>Yz!RP>RP>SP>qB!RP>RP>SP>3#L!RP>RP>SP>b!RP>RP>SP>/!RP>RP>SP>RG!RP>RP>SP>DR"!RP>RP>SP>9!RP>RP>SP>!RP>RP>SP>P]!RP>RP>SP><~!RP>RP>SP>dO !RP>RP>SP>->!RP>RP>SP>n.!RP>RP>SP>A8!RP>RP>SP>RP>SP> !RP>RP>SP>*"\!RP>RP>SP>I!RP>RP>SP> L!RP>RP>SP>|r)!RP>RP>SP>Z-U!RP>RP>SP>?V%!RP>RP>SP>;jZ!RP>RP>SP>&Qu!RP>RP>SP>gI&!RP>RP>SP> fy!RP>RP>SP>@!RP>RP>SP>hS8!RP>RP>SP>pŋ/!RP>RP>SP>%,!RP>RP>SP>~3!RP>RP>SP> 6r!RP>RP>SP> pY;x!RP>RP>SP>kI!RP>RP>SP>f!RP>RP>SP>RcH?!RP>RP>SP>i<9!RP>RP>SP>jWJ!RP>RP>SP>oPF!RP>RP>SP>4!RP>RP>SP>HE!RP>RP>SP>)?g!RP>RP>SP>'T!RP>RP>SP>'r7w!RP>RP>SP>2k!RP>RP>SP>b5J!RP>RP>SP>heEv!RP>RP>SP>< X{!RP>RP>SP>7G!RP>RP>SP>;;!RP>RP>SP>;Z%!RP>RP>SP>8g i!RP>RP>SP>@8zD5!RP>RP>SP>9=?ASP>SP>SP>b^^m%(<QP>QP>SP>p(![m SP>SP>SP>ɂyAQP>QP>SP>p?_^AQP>QP>SP>gtASP>SP>SP>)xSP>SP>SP>  Eew SP>SP>SP>'uHSP>SP>SP>P!SP>SP>SP>(AQP>QP>SP>_K^AQP>QP>SP>,,AQP>QP>SP>$ABAQP>QP>SP>%>MAQP>QP>SP>&vAQP>QP>SP>'AQP>SP>SP>0:.AQP>SP>SP>1}?ASP>SP>SP>2z ov SP>SP>SP>8@3SP>SP>SP>4ô6XwRAGM ),`~ &aG<c08F4J-r0Ԓ(M{x*%)?bh> 8) << 16) | ($1 % 256))) } # For the stallion devices tty[EF] # stallion major letter card iscallout stallion () { major=$1 letter=$2 card=$3 iscallout=$4 port=0 maxport=8 pref=tty owner= minorbase=0 if [ $iscallout -gt 0 ]; then pref=cua owner=uucp:dialer minorbase=128 fi case "$card" in [0-7]);; *) die 1 "Invalid stl card number $card";; esac # make the mem interface for extracting stats & loading microcode. # 0x1000000 + card number mknod staliomem$card c $major 0x0100000$card while [ $port -lt $maxport ]; do minor=$(($minorbase + $card * 1048576 + $port)) if [ $port -ge 32 ]; then minor=$(($minor + 65504)) fi unit=$(($card * 64 + $port)) mknod ${pref}${letter}$unit c $major $minor $owner mknod ${pref}i${letter}$unit c $major $(($minor + 32)) $owner mknod ${pref}l${letter}$unit c $major $(($minor + 64)) $owner port=$(($port + 1)) done } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV od0 # bdev, SCSI optical sh MAKEDEV ata # cdev, ATA control sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV ar0 ar1 # bdev, ATA RAID disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 jogdial sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker snd0 # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV urio0 uscanner0 umodem0 # cdev, USB devices too sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP sh MAKEDEV nsmb0 # cdev, SMB/CIFS sh MAKEDEV crypto # cdev, crypto sh MAKEDEV fw0 fw1 fw2 fw3 fwmem0 # cdev, firewire ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV od0 # bdev, SCSI optical sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 $(( 0 + $u)) root:operator mknod nrwt${u} c 10 $(( 4 + $u)) root:operator # default density, 1024b blocks # mknod rWt${u} c 10 $((64 + $u)) root:operator # mknod nrWt${u} c 10 $((68 + $u)) root:operator mknod rwt${u}b c 10 $((16 + $u)) root:operator # 60 megabytes mknod nrwt${u}b c 10 $((20 + $u)) root:operator mknod rwt${u}c c 10 $((24 + $u)) root:operator # 120 megabytes mknod nrwt${u}c c 10 $((28 + $u)) root:operator mknod rwt${u}d c 10 $((32 + $u)) root:operator # 150 megabytes mknod nrwt${u}d c 10 $((36 + $u)) root:operator # mknod rwt${u}e c 10 $((40 + $u)) root:operator # 300 megabytes? # mknod nrwt${u}e c 10 $((44 + $u)) root:operator # mknod rwt${u}f c 10 $((48 + $u)) root:operator # 600 megabytes? # mknod nrwt${u}f c 10 $((52 + $u)) root:operator umask 77 ;; # Individual slices. aacd*s*|ad*s*|ar*s*|afd*s*|amrd*s*|da*s*|od*s*|fla*s*|idad*s*|md*s*|mlxd*s*|pst*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in aacd*s*) name=aacd; chr=151;; ad*s*) name=ad; chr=116;; ar*s*) name=ar; chr=157;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; od*s*) name=od; chr=70;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; pst*s*) name=pst; chr=168;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in aacd*s*|amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|pst*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr $(($unit * 64)) root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr $(($unit * 64 + 1)) \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr $(($unit * 64 + 2)) \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr $(($unit * 64 + 3)) \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr $(($unit * 64 + 4)) \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr $(($unit * 64 + 5)) \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr $(($unit * 64 + 6)) \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr $(($unit * 64 + 7)) \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr $(($unit * 64 + 8)) \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr $(($unit * 64 + 9)) \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr $(($unit * 64 + 10)) \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 if [ `sysctl -n machdep.ispc98` -ne 0 ]; then mknod ${name}${unit}.1280 c $chr `expr $unit '*' 64 + 11` \ root:operator mknod r${name}${unit}.1280 c $chr `expr $unit '*' 64 + 11` \ root:operator mknod ${name}${unit}.1476 c $chr `expr $unit '*' 64 + 12` \ root:operator mknod r${name}${unit}.1476 c $chr `expr $unit '*' 64 + 12` \ root:operator fi ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; aacd*|ad*|ar*|afd*|amrd*|da*|od*|fla*|idad*|md*|mlxd*|pst*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in aacd*) name=aacd; chr=151;; ad*) name=ad; chr=116;; ar*) name=ar; chr=157;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; od*) name=od; chr=70;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; pst*) name=pst; chr=168;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in aacd*|amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|pst*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1h s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ata) mknod ata c 159 0 root:operator ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod ast${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 ast${unit} mknod nast${unit} c $chr $(($unit * 8 + 1)) root:operator chmod 640 nast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*t*) umask $disk_umask units=`expr $i : '...\(.*\)t'`; tracks=`expr $i : '.*t\(.*\)'`; name=acd; chr=117; if [ -z "${units}" ]; then units=0 fi if [ -z "${tracks}" ]; then tracks=100 fi if [ "${units}" -le 31 -a "${tracks}" -le 169 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}t* j=1 while [ $j -le ${tracks} ]; do mknod ${dname}t$j c $chr \ $((($i * 8) + (65536 * $j))) \ root:operator j=$(($j + 1)) done i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices or 169 tracks" fi umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" ]; then units=0 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator case $name in acd) ln -f ${dname}a ${dname}c;; *) mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator;; esac ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr $(($unit * 8 + 0)) root:operator mknod wcd${unit}c c $chr $(($unit * 8 + 2)) root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 `unit2minor $unit` ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 `unit2minor $unit` ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 `unit2minor $unit` ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 `unit2minor $unit` ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 `unit2minor $unit` ;; usb) mknod usb c 108 255 root:operator chmod 0660 usb ;; usb*) umask 7 unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 `unit2minor $unit` root:operator umask 77 ;; ucom*) umask 7 unit=`expr $i : 'ucom\(.*\)'` minor=$(($unit + 128)) minor=`unit2minor $(($unit + 128))` mknod ucom$unit c 138 $minor uucp:dialer umask 77 ;; uhid*) umask 7 unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 `unit2minor $unit` root:operator umask 77 ;; ums*) umask 7 unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 `unit2minor $unit` root:operator umask 77 ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=`unit2minor $unit` mknod ulpt$unit c 113 $minor minor=`unit2minor $(($unit + 64))` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) umask 7 unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 \ `unit2minor $(($unit * 16))` root:operator i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 \ `unit2minor $(($unit * 16 + $i))` root:operator i=$(($i + 1)) done else minor=`unit2minor $(($unit * 16 + $endpoint))` mknod ugen$unit.$endpoint c 114 $minor root:operator fi umask 77 ;; urio*) umask 7 unit=`expr $i : 'urio\(.*\)'` mknod urio$unit c 143 `unit2minor $unit` root:operator umask 77 ;; uscanner*) umask 7 unit=`expr $i : 'uscanner\(.*\)'` mknod uscanner$unit c 156 `unit2minor $unit` root:operator umask 77 ;; umodem*) umask 7 unit=`expr $i : 'umodem\(.*\)'` mknod umodem$unit c 124 `unit2minor $unit` uucp:dialer umask 77 ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 `unit2minor $unit` mknod lpctl$unit c 16 `unit2minor $(($unit + 128))` ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr `unit2minor $i` i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; nmdm*) units=`expr $i : 'nmdm\(.*\)'` chr=18 i=0 while [ $i -lt $units ]; do minor=`unit2minor $i` minor=$(($minor + $minor)) mknod nmdm${i}A c $chr $minor mknod nmdm${i}B c $chr $(($minor + 1)) i=$(($i + 1)) done ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 `unit2minor $unit` unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cua?|cuaa?|cuaa??) umask 7 unit_low=`expr $i : 'cua.*\(.\)$'` case $i in cua?|cuaa?) unit_high="" m_high=0 ;; cuaa??) unit_high=`expr $i : 'cuaa\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod cuaa$unit c 28 $(($m | 128)) uucp:dialer mknod cuaia$unit c 28 $(($m | 32 | 128)) uucp:dialer mknod cuala$unit c 28 $(($m | 64 | 128)) uucp:dialer umask 77 ;; crypto) mknod crypto c 70 0 root:operator chmod 666 crypto ;; fwmem*) unit=`expr $i : 'fwmem\(.*\)'` mknod fwmem$unit c 127 $((1<<24 | $unit)) root:operator chmod 660 fwmem$unit ;; fw*) unit=`expr $i : 'fw\(.*\)'` mknod fw$unit c 127 $unit root:operator chmod 660 fw$unit ;; tty?|tty0?|ttyd?|ttyd??) unit_low=`expr $i : 'tty.*\(.\)$'` case $i in tty?|tty0?|ttyd?) unit_high="" m_high=0 ;; ttyd??) unit_high=`expr $i : 'ttyd\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 $(($m | 32)) mknod ttyld$unit c 28 $(($m | 64)) ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuac$name c $major $(($minor + 128)) uucp:dialer mknod cuaic$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualc$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major $(($minor + 32)) mknod ttylc$name c $major $(($minor + 64)) done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 $(($m + 128)) uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major $(($minor + 65536)) mknod ttylA$name c $major $(($minor + 131072)) port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod cuaA$name c $major $(($minor + 128)) uucp:dialer mknod cuaiA$name c $major $(($minor + 128 + 65536)) \ uucp:dialer mknod cualA$name c $major $(($minor + 128 + 131072)) \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Alpha AS8[24]00 (TurboLaser) console. zs?) unit=`expr $i : 'zs.*\(.\)$'` m=`ttyminor $unit` mknod zs$unit c 135 $m ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major $(($minor + 32)) mknod ttylD$name c $major $(($minor + 64)) done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuaD$name c $major $(($minor + 128)) uucp:dialer mknod cuaiD$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualD$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; # Stallion multi serial cards (stl and stli drivers) # # These drivers reserve 64 minor devices per board, even if the board # supports only 4 devices. We default to creating only 8 of the 64 devices # to keep /dev from getting too large (which => slow). The last part of the # arg is the board number to create ports for. So: # ttyE0 will create 8 dialin ports ttyE0-ttyE7, plus ttyiE* and ttylE* # cuaE0 will create 8 dialout ports cuaE0-cuaE7, plus cuaiE* and cualE* # ttyE1 will create 8 dialin ports ttyE64-ttyE71, plus ttyiE* and ttylE* # etc # If you have EasyConnect 8/32 or 8/64 cards, you will need to change the # definition of "maxport" below to get nodes for the full 32 or 64 # ports per card. # # Note that the mapping of minor device numbers (with the hole between # 32-64k) is a bit odd to keep compatibility with ttyd? for # lock/initial devices. # Minor device field for the ports is # card{3} unused{4} unit-msb{1} unused{8} callout{1} lock{1} init{1} unit-lsbs{5} # for the mem device is # 0x1000000 + card # (For stl, there is only 1 mem device per system; for stli, one per board) ttyE*) stallion 72 E `expr $i : 'tty.*\(.\)$'` 0 ;; cuaE*) stallion 72 E `expr $i : 'cua.*\(.\)$'` 1 ;; stl*) card=`expr $i : 'stl\(.\)$'` stallion 72 E $card 0 stallion 72 E $card 1 ;; ttyF*) stallion 75 F `expr $i : 'tty.*\(.\)$'` 0 ;; cuaF*) stallion 75 F `expr $i : 'cua.*\(.\)$'` 1 ;; stli*) card=`expr $i : 'stl\(.\)$'` stallion 75 F $card 0 stallion 75 F $card 1 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major $(($minor + 64)) mknod ttylM$name c $major $(($minor + 128)) done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major $(($minor + 262144)) \ uucp:dialer mknod cuaiM$name c $major $(($minor + 64 + 262144)) \ uucp:dialer mknod cualM$name c $major $(($minor + 128 + 262144)) \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f ttyR* ttyiR* ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod ttyR$Rnum c $major $MINOR mknod ttyiR$Rnum c $major $(($MINOR + 32)) mknod ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f cuaR* cuaiR* cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 # non-blocking for X11 mknod mse$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 # non-blocking for X11 mknod psm$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss ln -fs dsp$unit.0 dsp$unit ln -fs audio$unit.0 audio$unit ln -fs dspW$unit.0 dspW$unit mknod mixer$unit c $chr `unit2minor $(($unit * 16 + 0))` mknod sequencer$unit c $chr `unit2minor $(($unit * 16 + 1))` mknod midi$unit c $chr `unit2minor $(($unit * 16 + 2))` for chn in 0 1 2 3 do minor=$(($chn * 65536 + $unit * 16)) mknod dsp$unit.$chn c $chr $(($minor + 3)) mknod audio$unit.$chn c $chr $(($minor + 4)) mknod dspW$unit.$chn c $chr $(($minor + 5)) done mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `unit2minor $(($unit * 16 + 8))` mknod pss$unit c $chr `unit2minor $(($unit * 16 + 9))` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 `unit2minor $unit` mknod gsc${unit}p c 47 `unit2minor $(($unit + 8))` mknod gsc${unit}d c 47 `unit2minor $(($unit + 32))` mknod gsc${unit}pd c 47 `unit2minor $(($unit + 40))` chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr `unit2minor $unit` chmod 644 card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=$(($unit + 16));; ttyz?) unit=$(($unit + 32));; esac mknod $i c 42 $unit ;; cronyx) mknod cronyx c 42 63 ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 sp . ..MAKEDEVconsolekmem2 memnull2 random urandom zero2 io ttyklog2stdin2stdoutstderr pci fd fd0rfd0)fd0a)rfd0a)fd0b)rfd0b)fd0c)rfd0c)fd0d)rfd0d)fd0e)rfd0e)fd0f)rfd0f)fd0g)rfd0g)fd0h)rfd0h)fd0.1720k rfd0.1720) fd0.1480k  rfd0.1480)!fd0.1440k! rfd0.1440)"fd0.1200k" rfd0.1200)#fd0.820#rfd0.820)$fd0.800$rfd0.800)%fd0.720%rfd0.720)&fd0.360&rfd0.360)'fd0.640'rfd0.640)(fd0.1232k( rfd0.1232)) da0)rda0)*da0a2*rda0a)+da0b2+rda0b),da0c2,rda0c)-da0d2-rda0d).da0e2.rda0e)/da0f2/rda0f)0da0g20rda0g)1da0h21rda0h)2da0s122rda0s13da0s1a3rda0s1a4da0s1b4rda0s1b5da0s1c5rda0s1c6da0s1d6rda0s1d7da0s1e7rda0s1e8da0s1f8rda0s1f9da0s1g9rda0s1g:da0s1h:rda0s1h;da0s22;rda0s2<da0s32<rda0s3=da0s42=rda0s4> od0>rod0)?od0a2?rod0a)@od0b2@rod0b)Aod0c2Arod0c)Bod0d2Brod0d)Cod0e2Crod0e)Dod0f2Drod0f)Eod0g2Erod0g)Fod0h2Frod0h)God0s12Grod0s1Hod0s1aHrod0s1aIod0s1bIrod0s1bJod0s1cJrod0s1cKod0s1dKrod0s1dLod0s1eLrod0s1eMod0s1fMrod0s1fNod0s1gNrod0s1gOod0s1hOrod0s1hPod0s22Prod0s2Qod0s32Qrod0s3Rod0s42Rrod0s4S ad0Srad0)Tad0a2Trad0a)Uad0b2Urad0b)Vad0c2Vrad0c)Wad0d2Wrad0d)Xad0e2Xrad0e)Yad0f2Yrad0f)Zad0g2Zrad0g)[ad0h2[rad0h)\ad0s12\rad0s1]ad0s1a]rad0s1a^ad0s1b^rad0s1b_ad0s1c_rad0s1c`ad0s1d`rad0s1daad0s1earad0s1ebad0s1fbrad0s1fcad0s1gcrad0s1gdad0s1hdrad0s1head0s22erad0s2fad0s32frad0s3gad0s42grad0s4hacd0a2hacd0c)hracd0ahracd0ciafd02irafd0)jafd0a2jrafd0akafd0b2krafd0blafd0c2lrafd0cmafd0d2mrafd0dnafd0e2nrafd0eoafd0f2orafd0fpafd0g2prafd0gqafd0h2qrafd0hrafd0s1rrafd0s1safd0s1asrafd0s1a)tafd0s1btrafd0s1b)uafd0s1curafd0s1c)vafd0s1dvrafd0s1d)wafd0s1ewrafd0s1e)xafd0s1fxrafd0s1f)yafd0s1gyrafd0s1g)zafd0s1hzrafd0s1h){afd0s2{rafd0s2|afd0s3|rafd0s3}afd0s4}rafd0s4~ast02nast02 wd0rwd0)wd0a2rwd0a)wd0b2rwd0b)wd0c2rwd0c)wd0d2rwd0d)wd0e2rwd0e)wd0f2rwd0f)wd0g2rwd0g)wd0h2rwd0h)wd0s12rwd0s1wd0s1arwd0s1awd0s1brwd0s1bwd0s1crwd0s1cwd0s1drwd0s1dwd0s1erwd0s1ewd0s1frwd0s1fwd0s1grwd0s1gwd0s1hrwd0s1hwd0s22rwd0s2wd0s32rwd0s3wd0s42rwd0s4wcd0a2wcd0c2rwcd0arwcd0cwfd02rwfd0)wfd0a2rwfd0awfd0b2rwfd0bwfd0c2rwfd0cwfd0d2rwfd0dwfd0e2rwfd0ewfd0f2rwfd0fwfd0g2rwfd0gwfd0h2rwfd0hwfd0s1rwfd0s1wfd0s1arwfd0s1a)wfd0s1brwfd0s1b)wfd0s1crwfd0s1c)wfd0s1drwfd0s1d)wfd0s1erwfd0s1e)wfd0s1frwfd0s1f)wfd0s1grwfd0s1g)wfd0s1hrwfd0s1h)wfd0s2rwfd0s2wfd0s3rwfd0s3wfd0s4rwfd0s4rwst02 vn0rvn0)vn0a2rvn0a)vn0b2rvn0b)vn0c2rvn0c)vn0d2rvn0d)vn0e2rvn0e)vn0f2rvn0f)vn0g2rvn0g)vn0h2rvn0h)vn0s12rvn0s1vn0s1arvn0s1avn0s1brvn0s1bvn0s1crvn0s1cvn0s1drvn0s1dvn0s1ervn0s1evn0s1frvn0s1fvn0s1grvn0s1gvn0s1hrvn0s1hvn0s22rvn0s2vn0s32rvn0s3vn0s42rvn0s4cd0a2cd0c2rcd0a)rcd0c)sa0.ctlrsa0.ctl)sa0.02rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.12rsa0.1nsa0.1nrsa0.1 sa0esa0.1ersa0.1sa0.22rsa0.2nsa0.2nrsa0.2esa0.2ersa0.2sa0.32rsa0.3nsa0.3nrsa0.3esa0.3ersa0.3rsa0)nsa0)nrsa0)esa0)ersa0)ttyv02ttyv12 vgacuaa02cuaia0cuala0ttyp02ptyp02ttyp12ptyp12ttyp22ptyp22ttyp32ptyp32ttyp42ptyp42ttyp52ptyp52ttyp62ptyp62ttyp72ptyp72ttyp82ptyp82ttyp92ptyp92ttypa2ptypa2ttypb2ptypb2ttypc2ptypc2ttypd2ptypd2ttype2ptype2ttypf2ptypf2ttypg2ptypg2ttyph2ptyph2ttypi2ptypi2ttypj2ptypj2ttypk2ptypk2ttypl2ptypl2ttypm2ptypm2ttypn2ptypn2ttypo2ptypo2 ttypp2 ptypp2 ttypq2 ptypq2 ttypr2ptypr2ttyps2ptyps2ttypt2ptypt2ttypu2ptypu2ttypv2ptypv2ttyd02ttyid0ttyld0 zs0kbd02mse02psm02sysmousek consolectl lpt02!lpctl0"ppi02#iic02$smb02%ums02&tun02'tap02( ch0) apm*apmctl+card02,pass02-xpt02. i4b/i4bctl0i4btrc01i4btrc12i4btel03i4bteld0k4i4brbch0k#!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.2 2002/08/08 08:23:53 ru Exp $ # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac 9 ...: . ..; protocols<group=spwd.db>services# # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.3 2002/02/27 03:39:00 dd Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.iana.org/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crudp 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved A ...B ...C ...D ...# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) E . ..FshareF .E ..GmiscG .F ..H scsi_modes*t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; : # $FreeBSD: src/release/fixit.profile,v 1.8.2.1 2001/11/05 11:22:04 brian Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / # SCSI mode page data base. # Copyright (c) 1995 HD Associates # Copyright (c) 2001 The FreeBSD Project # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.4 2002/03/14 16:18:48 joerg Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # 'i' is a byte-sized integral types, followed by a field width of # 1 through 4 (1 to 4 bytes). # # 'b' is a bit-sized integral type # 't' is a bitfield type- followed by a bit field width # # 'c' values are character arrays # 'z' values are null-padded strings # # # '*' suppresses assignment (for 'seeking'). # Bitfields are MSB to LSB. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } # SEQUENTIAL ACCESS DEVICES 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } # CD-ROM (and CD-R[W]) devices 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved}  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxELF 494 ( L9 L9 `9 ```FreeBSDS U WVSҍu^|=~)}t#E`8t8/u H `@8ut RShS\$t$|$D$0 e[^_ÐU=hu@vdd@Сd8ut hRk~hÍvUUthRhR3~ÐUU WVS} t8uj/7輏pu7lt'PVUH u;tuWuCVh@hM5\Q" e[^_ÐUVS]j/S>ޅtpl=lt$3VG u  v;u1e[^ÍvUVSu] uSNVe[^U WVSh@h5\Qc El=lt\v>ӋE؃OEh5\Q ]6h5\Q >uh5\Qܹ jf. Uuu uÍvU WVS}] hej@$RRvRRvRhR\RRFj5XQ(/vR h5\Qݸ jg- vhfSWYN-5Ã=Ru-=Ru$=Ru=Ru=Ru =Rt jjS95XQXL thj65R, U WVSEEvt޿uR1WvRjSӓ ƃ}:MQ8-ujSƃ}Sh NR_} t>u5TQpChVH ƃVS V[K VWt V+ tEUEe[^_UWVS};=TQuG t$fG EE f  uv=RtM}u:XQBHJȅ|  Rj  =E=RtL=RuCE]S=Rt,EEPh5XQ) XQ@ @E uS=RNXQBHJȅ};B|$$Rj$  =RXQBXZ؅};B|^^Rj^ %XQBHJȅ};B|IIRjI=RkƀvV  N4%XQBXZ؅};B|MMRjM eXQBHJȅ};B|--Rj- %vV  N4%XQBXZ؅};B|^^Rj^ ?t@ XQAPQЅ} ;A| t ڈ1vQS6 XQAXY؅} ;A|< tvQV t2GPWЅ}WTE 0lG @t$5Rh υRg XQ@ @thje[^_UlWVSXQx=EPW) t5Rh j褃E=sRP_ uGhjl1SPW& }hj?v)ƅũ5R5EP& Ã}5Rh 讄Re[^_U|WVSjjuV襱 jjjS(à Euh jh}Wo эAPVS( }S% |UE t t(FjS'u1h"jS&u hh؍x[^_ÍvUuu uÍvUMqh@ wjEPURmEE vt8A %Ph}Ehh jtE%f=@t"Y=hh jtv1=8SutMA j=$StSQ=SEP.=$StSQVSUR SMQtEE= St!}uhEph` 7EUREf<8thj jsEh[^_ÉUEP4t4 t/t*E @4t ttut1vÐUWVSjjEpI~ EuUrh thMIFv1`S8UvRDN4>FvPt'1N4`SFv&v1N4`SFv8U`SjSEEEE exU[^_UtS]EPsushjZE%f=uK E%f= t f=`EPhzf@sushj,ZEt K*v t#tEEPhmdsKE%f= uKEuEK?v["jjjs uu5"8uKK]ÍvUVS(U5,UjjVS!jjVSt3@UDUHULU ,U9w9(U`Tt0t5Tj v5Tj5Tj 5T5T5TY uTovaTu5ThjX5Th)ZDTt7jT1RP5T щƒ t5ThYbTT T9uTT@UDU4vbTtTT TTHULU`Tt&TTjTt+TthUlUHPTPP1TT4Uve[^ÐU4U=u v=u =u` `TtFTtET9s3t )Pj )Pj5TA TT=Tu  t jÉU WVS=T}t TE TUvu1bT tB19s?u-@9s<8t1҅t}u5 }tjRP5T uu5Th@jUv}tjW5T IVW5T Ã;u5ThdjZV8t5Thj1U1߉ؙpUtU;]u U;TPUTUeXU\U9tRTt5ThjUt)=HSu HS5Th6W)4T+UTT9rEXU\UЅtRT)P5T9| TTTe[^_ÐUWVSj]S>EEEݝxCEE܅x%xUݕxEuݝx؃XU\URPPUTURPHULURP@UDURPh@jd]Sb@ 0߰эAPSj lU hU\thn=hUu uhPhUlURPhujd\R? \эAP\Rj\  dU `U`Utdnu uhP`UdURPhjd\Rt? \эAP\Rj pU5tU]um۽`jjVS}-ۭ`۽`ۭ`]Eܵx$|xVShjd\P> 0\эAP\Rj7 H[^_US0q$[ÍvUS]U%PUWVSTj T1ۡTE5TUTEEURP5TK =4}8&5ThMjPv=T}hPh[jQv=TT5TEW5T5T ~$Tt)=Tu4 u=v\hnj%QaTt+}u=5ThMQE5ThMjOv 2e[^_ÉUWVS T 'j T1ۡUE5UUUEEURP5T 85ThMj!OUPDž}hh[jPtGfEUUBRhm5Tbq5ThMjN11M=U@5T5T5T u5ThMjUNfEE@Phm5Tu5ThMjNv؉O99U5T5T5TJ u5ThMjM;Tt5ThjNv؉O9u,9Uw"vG9u 9Ue[^_ÐUuu uÍvUWVSDžDž|tpEl#5$|HhvhvVVvVVv vh.|thj@MPQhSVIV=|th jL$R|{ hE PURN5)EU U jtPƃjpRAz ~*1PpP4 KuDžxU :|PVtRwƃjpPy 9x})1PpRKu܅~XDžh1=Hu D82upPhP~hKuj lRE 0t}=U 2<ÃE 0hDKDžxE%f= bU 2ÃMUU UhGǃuhV^KDžxyvW#7 ÃuWhd,KDžxQVjSPtM1pRE 0u xtxSW VSpuƅpRVE 0hDzJDžxjSZSE Wu uvU VS}ShDJDžx<}u$jpPw VpR! pPVE U :xH[^_ÉU WVSjEPU19}51ۃEPEP u ]CLF9|1e[^_ÍvU,WVSE}u"=VujPE EEEE 9EULUM11؉ @Fj,PF ue[^_ÐUuu uÍvU WVS] 3t #u1װэA~{u|\u|cu D3h #3;t;XQBHJȅ};B|  Rj ;uu/XQBHJȅ|  vRj j Uuu uEÍvUj , uh ,jD;EU AQÉU WVS]j EtSUBuh ,j:v1=wB%1u;-u2/=wB%v1u1Bt'߰эA9rtU vEEe[^_UUHw r ÉU WVS}t]u1Yj jw*gÉe8th,j9w _w1ҍe[^_ÉUVSuHvAjW Ãuh ,jo9vFVRPh#,Sa^e[^ÐUE8%ÐUWS4vu 14v߰u Ph(,B tLZv߰u3{=u-<u$SgPve[_ÉUVS];uC C%*1C8tS)щ t C Cue[^ÍvUS] h6,j'4v Hv8uPHQRh7, ph=,5HvC]ÉUhA,j7vUVS]u S uV9 S+e[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9V W wv_1RP8VgW^ 11ɋG9FuG9F1QRÃVW؍e[^_U WVSu} VuWt9V\WS wv^1RP;VW 11ۋVG9 uG9Fv1SQ&ÃV@W7؍e[^_ÐU WVSu} VuWt=VW wv^1RPà DVW 11ۋWF9 uF9Gv1SQZÃVtWk؍e[^_ÐU WVSu} VDuW4tIVW wvK]Љ҉1RPà DVW 11ۋWF9uF9Gw1SQÃVW؍e[^_ÐU WVSu} VluW\t9VW wvs\1RP;V7W. 11ۋVG9uG9Fw1SQÃVW؍e[^_ÐU WVSu} VuWt9V(W wv[1RP7VoWf 11ɋG9FuG9Ft1QRÃVW؍e[^_ÐUWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vщƒ tWщƒ uhN,j1FVGWRP"ÃCSRPGWRPFVRP,0th,jV1VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} Vщƒ tWщƒ uhN,j0FV+GWRPÃCSRPGWRPFVRP,0th,jN0VW؍e[^_UVSUM ]u tQREURP#9u9t1e[^ÍvUWVS}Wщƒ tE Pщƒ uhN,j/O_U BREUEuUEEEURPƃFVRPU BRRPGWRP0th,j+/vWU Re[^_ÐUSEU M]uuuu v1[ÍvU WVS}] Wщƒ tSщƒ uhN,j.C Cuhc,jq.CSRPGWRPtRPƋCSRPGWRP/ th,j!.WSe[^_U WVS}u Wщƒ tVщƒ uhN,j-F Fuhc,j-FVRPGWRPRPÃW3 V'؍e[^_ÐU<WVSuVE P jE p]S4߅t$hSWP3Sht,j,jEPjvW2 u=E Eu5}|VEEFP5E؋U+EURP6!}ujj" h6,SÃV-E P! Wy؍[^_U WVS5$vu ''~'Dv=8v)t6SPe v6S tiDvx8vTvtPR% vPp t(Tv0v5$vDv,v1e[^_ÍvU WVS3AQ QA4}8E<}@ED}H|Lxt4?t14:u <:u0BBB448uЀz:u ?3f8RpwP@Ph3G v }u"fu@=vu7p@ pz@.u=vuB vpA&;EvE=vu =vt$pG&P@P;EvE\dpp4=t44S4=tH4EPeSPSjP]S 5XQSf]ÐUU=vtF@XQBHJȅ};B|/mRj/[%=w=tQ=@t"==XQBHJȅ};B}Rj/vXQBHJȅ};B||Rj|XQBHJȅ};B|@Rj@XQBHJȅ};B| =hRj=ZXQBHJȅ};B| %XQBHJȅ} ;B| t vRSF=vXQBHJȅ};B| \Rj\蝌CU$4vXQBXZ؅};B|\vRj\XQBHJȅ};B|"BRj"_XQBXZ؅};B|aRja+XQBHJȅ};B|bRjbXQBXZ؅};B|fRjfXQBHJȅ};B|nrRjnXQBXZ؅};B|r>Rjr^XQBHJȅ};B|tRjt.XQBXZ؅};B|vRjv蹊E%H0XQBXZ؅} ;B| t vRQnEH0XQBXZ؅} ;B| t RQ.EH0XQBXZ؅} ;B| t vRQXQBHJȅ};B| \Rj\豉E%H0XQBXZ؅} ;B| t RQnEH0XQBXZ؅} ;B| t RQ.EH0XQBXZ؅} ;B| t vRQEGe[^_Uh65\Q& j! Uuu uÍvUWVSu] EEFpt# ?t4mt -vt%$EEvvh 7SV蔻u5Ã;u}u HvEPLJƃuEPh7jhVHVb E;}tW3xW3}J8t 跾8u35Ph'7 3h'71!=vt3h*7 Uu Et2}t,W3ŝu3h'7RE;EP U|WVS}E fEfEE;/uCE1vu  vSVuС59u1;tC3}3h->t3 ƃ;uV~ UWS]ډװэD H9v8/t@4H9v8/t@Si}Sh->hj/Su1e[_ÐUh@>5\Q j ~ Uuu uÍvUWVS]u EE}ohK?VSu5)Í4tDEEEvRrc  N4%@uEE-uE+u@EEwB%1t&j URQ~~ v1ɉMGE8.u]gfffEPU@=wB%1t#EC)‰хu}u}~jWfQj]| UhL?5\Q j9| Uuu uÍvUYj| vUuu uÍvUWVS}u j/6ÍCu\wxoƒTw+Lvܙ}=Lt+Lc=Lt*LG=Lt*L+!=Lt*L*hqGU RMQʒ5)E} <} =ԙt=Lu4L(=Lu L}*U ؙ8/tGjcPh~GhG5HkHӉ߰ʉH v=L%P5?豕8ugؙ8/t]Ph~GhG5kװсx H=L%PR}5hGjvL$Hv}t(RRÃQSPVvDžVhmdWrhGjv}ti(PÃS5XQq S 6=ԙt7}u1hjU r,Ehhk }t'hGM q*1u} whGj^hPu jn PhhÉ߾EShW Vv}uE @E}t('hRM q&WhhÉ߾E SDžVhmdPphGj7vR ËE}uhj} wmPhhÉߋES uShW6P"m U WVS]޿Hu #ScuShHjH}E=uAUBt78/tPhHhHhgPh^p=uCMAt98/tPhHhHhfPhpj]S\} tjE PSAe[^_U WVS}u=ܙt$hH[$V5XQsvVc#WEVdžWEVfdž1ɉ9s f3 9rf=VhfdWSn}$?8t58thIvjjjWk E]ShmdWn }hGu Wj ;u$t25PWj ;th'IIvEShmdW~m,VhgdWmm}h-I1e[^_ÉUS]-tRtmtSt`Sh>Ih`IShIhI5\QS/Sh JjcSh`J j]ÐUSE=h hPzi =5hGjv̼wn=WEVtv̼wT;WEVu틃=WEVu̼w7;WEVu/=WEVu(1ɉ9s f3 9rft=hJjJShedAPk}hJj؋]ÐU|WVSE x(u@(ǀ UUM I(Mh}W=ԙuY=*h EPu(h =5hGj}hUR;=tMM}}=j/5ؙou ؙvAEEUUvHAH9t$=wB%1tơHH=u$hHhJha=u$hHhJh{aj5Nƃ}5hGj0M q([ Ãu5hGj} w(EPS` w(URVmf }5hGjVf 1҃<Bu v}S^\ j5vƃ }5hGjX}WVgt5hGj/vE MЋ]H(19u9v5hKjU B(ы)REPVbe }5hGjVe M}9s9th KjA;MrEx[^_UWVSu} 5hLKVYf wG4hSKGPh]KV%GPjhgKVGPjhsKV hKVGXthKVGXthKVGXthKVhKVw(hKV w,hKVtw0hKVc w8hKVOw4hKV> wu"Et }E1BЃ M̍DBЉEt Uh@chch_5\QjB> US]Qhau,vShcS C~ S]ÉUVS]Bj hVTuhc@vBP PBPhc CPPL)@ h} PPL)@PPhc OPNȃ?PP%PKPJȃ?PL%Ph d\ FPhddHe[^ÐUf`UÉU WVSu=H)CăhhhWVRC fCCCC C hhhW+5hVe[^_ÉU,WVSEBEPhdEP =hdy=t;j S}u'jhd jEECEEES hC)ЍpPEPhetECPEPh ertECEEEPhe: tjuEPWEPhe!t}VEPh%etuh@eB#K S%<C E?!փWEPheet}EPEPhxetEEVEPhettuf{ CEC f{CECKS %<C E?!փWEPhet}EPEPhetEEVEPhetuf{C EC QC PCPC PVWFC fCCCC C C PC PCPV>+hP EP%hee[^_ÉUhee5h5@5D5h f@0h`f05d5P5T5Lh f ÐU WVSbhf tZuSVhft]CvhfÐh gtLe[^_Uh@gt%ÍvUShgc]5LShgtEL5TShgtET5PShgtEPTPdAh gi]UWVS}u}u} ufECdUE}ËE)EPUE}EfU(‹E[^_ÐUtSEP5l7Ãu5lhgE u5lh h?=u=u=u}t1P5ljÉXu"Z8uB5lhCh*jÃtX5lh`h衔؋]ÉUEU j RP5X6 =~Ru5XB5 UEU j RP5X5 =~Ru5X4 UShhedA5X7taL  D T@P£hdʉ H~5lhheLDT@PhdH]ÍvUShbjjDÃu hhf=`Uu1hi諒]ÐUS=\tjF11hbjj#Ãt1h@ik؋]UWVuhbi5TQjdhװшD =tSֿjit9ֿnit&ֿritֿtiu1e^_ÍvU WVS1۾EPEPhi5TQjdhшD =t"At t tu1dAtBЃ w \Bv t uAt( t tthhih8E e[^_ÉU WVSu 6uhj)5TQjdS,߰шD =u 1vCt t t"u!Ct-"t(Ct"uCt t u>эQ  B~@e[^_ÐUS1ɺ]v9uBA|%j[ÍvUuu u!ÍvUh k5\QϻjY0 UVSu8Uj EPVU8tVhUkj|E8tu VhXkjl؍e[^ÍvUS];uhkjBSguhkSZ@]US];uhkjSIuhkS@]UWVS} EvGuՃ(t>hpw(?< t 0hp w(ho=tFW4G8utPRhputPRhpehpUe[^_ÐU WVS}jEPnp|MvWEP8tWELP8u] Ny1e[^_ÐU WVS]u t>utd;t_߰҉щMQ% ǃuhZpj=}VShqEPWi vVǃt S e[^_ÍvUWVSEU EEERtL-u%UCj=Pφt.@U!vƿtntUqCChpEP5huU e[^_ÐUWVS}uh&p4vh qE PhqE P uEEEEEEL q߹u E P q߹u EPSEPEhpEPTgÃuEPS EPG 1EE v߰эAP ǃuhZpj2{qfqGSW!WVv W jShqf uCPVFSV%ƃhpEPsfÃFEPn e[^_U WVSEth8tc} t]U :tUƉu}1vSE PS5t>,u;tFCFuN,hpWeÃue[^_Uh qh`qhqhq5\Q jo vU WVS]s0ƃV{nu~ou EEj=V~t@] t[װэyWRV~uԋt<=uDžt'U{ tUE;Cu[ (C!v=uVh ujtv1h uV2ƃ'EP e[^_ÍvUVSUM ΀:t"YvB:/uz/tBـ:u)~y/u Av[^ÐUtS] Su5t3EPSBuE%f=@t1Sh(uj@tx;0PShVH }uEE PU @ {&$P|vIj)jD I= ~~=th {5XQ蒙hyjDjt) 0=th'{5XQThjh {a,T!"j=th@{5XQjCj( =thW{5XQޘhjh {+hy"R&j4 l'=t6=th{5XQ{hjh {+jhy@thy#CY-+hy0" %j4&jhy^@ Gj'jB M}hVE 0E  Vsà th8SW*M}uvkGji'jKB M}t\hVE 0E  Vrà t'=t WihSW+*M}u"$j2=t%j@8Uh}h`}h}h~h@~h}~5\Q蚖 j8UWVSE 0UNMr9-iP% ËE t(}эAPEEujj gvEU:vMuUPh~Oi>эAPm‰ujj~f-MB6BP %}uE-@EEUMAMEE8<}tUM uE +KUe[^_U@ WSEEE@EE켺EEPEPhPh5h褰t7}tEEEPEPhPPPj 9'$(װэAPh7RNpS$oǃ=t S fhWS&װэAPh;RowSnǃWR3uSh>5\QuSP\ _vװэAPhSRFoS5t@uShZ5\Q菒hԽpS%װэAPhvRngj3.=t zvװэAPh~R^nhhhhh h@hhhh@h`hhhhhh8h`5\QoPvװэAPhRm[PPװэAPhRnmuh5\Qː2Ph5\Q誐װэAPh"װэAPhRlwװэAPhRl?=t"h5\QXh5\Qُ:װэAPhłR"lj+װэAPh΂RkJװэAPhӂRkuK=t"hق5\Qdh5\QFPh5\Q辎%[_ÉU WVS] u~=vh5\Qm5\Q 5hh= tэAJ< t< tBShk‰^4:u&UREPURjEUD,h5ƒ:u =/u$URURPCCPEPhhSK UREPSnFPjj@UR}v4h!5\QFtUFEPFV)‹F4UR\EUDFPVuFP[^_ÍvUVS]vC< t< tu   \u#Cuh@5\Q)Pv 't "tCF<C v CF8tuCuPhc5\Q؋K< t < tx؍e[^U WVS]޿otjhqShutU +;/uoM fqU fsB} ҉эD ;Erh5\Qjx,SE Pu >t'FS/u /F/tӀ>uK;/uu >tsFF5XQ~sCPJ(ssSVSX$ u;5V; Ã~N(rq=t S "PhP5XQ.~ {uSSS##SPst @C @ [u;5Ne[^_ÉUWVSEEM IЉUEPs ǃt3Mw+ƃuh\Y9tEU RƃtM^[t9uEu_9t[}uWRW" 8v=t W Ph5XQ| WO1eEt"t F;EuUt G;EtM}E$Nv}uWRW" vW7OURE PURX Ã}u SPK=}SVPEPURv}uFuf fFFuZEPVPOURVP"N = V4VPEPUR:v~u"EV&PEPhvMURE PUR\ÀK=SUPEPURPhv}u~WPW E PE PURÃ}u SOK= S7UPEPURPh=}uOO=WTPEPURFthVrS~ujE Pƃt4~th V=t SPh=5XQ?w SLS [u;j5@tr^td{uVf{th[S=P=t SPh=5XQv SpLS[ [uv ue[^_ÉU WVS=th5XQgv1@@t0v{ts C SBKSG uӅu@thS^O[ ue[^_U WVS=Ru=tIh5XQu1=th5XQu5EPjbN vV/ÃuVhQSPh5\Qu5Vhh tquuh ?XV?Ã=uWe[^_ÍvUWVSu} WÃuVWh5>hhV=}RVh 5\Qva5\Q褶 0Ph5\QBa1Xvss5  0s ~SWPbuN55h@5\Q`/0LPhj5\Q`0j=ugSWPuN55h@5\QF`0ܪPht5\Q#`0jPWPH[^_UutÐU,WVS}u jj%_Ãuh <Mb)ʍ)`  {EC td}܋FE~Mb)‰UFE~Mb)‰UfEFdEFpEFtEQj$jEP؍e[^_ÉUSMMb)ڍ)Ћ`tv9Htu1[U(= #th = #th uUS]t;r1'15$ѡ t 9Xt @ u1[ÍvUVSu] t;5rVh`:15$ sC =t!9suhS6[ ue[^US]t;rSh915$ t9Xu@@ P @ uSh29]ÍvU WVSujÃtUFB|jEPS(}:0/Phh5\QvS EPh/v5=)=t5`5h5XQX<~" PPEЃh= T[^ÐU=uKu u5Yu/V0sP55h@5\Q;UE jRP5˰uCu>0P55h5\QW;0jÉUUE =~/PRh5h5\Q; jnRh躳U5h5\Q:j3vUS] Su53]ÐUS] h']ÉUÍvU WVSL;P}h TPL0~TKu=Pu P5 1=XtVTP|VTP5HDÃLuC9P}-~)=th45XQ9PLtu!~] 9tPt)ޅO<t=tRSh`5XQ9؅} P6h5\Q8$<t7 <t!v<t h,h 5hΞ5hܞ5\Q8=uh:u j Sj5T¦=XtjS+.vjؙRP5HJщ1u %t1n0苂Ph5\Q7 j9=th5XQ7=Lu4@PPEPsvt PWh@hh`=TW 0h5TLEP/`Pe[^_U~THuL=Xt P5T; P5T5H00Phe5\QM6 jt-hhPh5\Q6 j P=tPhߟ5XQ5UH|=Xt7 PÐU WVSu=V'F=ltIP=l=@u)=th5XQF5@Vd=@gVhPh xPh&vS]1҉󫋅FF F FFFF fF "fF"$&(F(F,,FHTF0XF8\F@`hdPP, kuSu 1OFlN(^,ȉڃu uE=v>F %f=@u/=u/ȉڅuthc=tF(V,щ‰ȉF(V,Bwq$`F F(F,~ J19}CA;|/xu DFRh@2=DtF$F&FP=t V[^_U WVS}?uo|=DtxPh5\Q(2|tPh5\Q2h5\Q1``@wO$hh.hѠ"RhRh h!5\Qu1`HD9tPRh@5\QP1h5\Q:11Ƀ?t+19}5vu<tA@9| D`@G`e[^_ÐU WVS$ vExlt&dURtU9BuڋEH$1ۋU;}5ׁǤ<;t VCE;|dURZtU9Bu~E UBfd@#dtjI>|2&h 5h d~Ph5\QP/d[^_ÍvU WVS]1=@u ;Nu3[ǃNuIu"55Wh 5\Q.1e[^_ÉUE Pu5\Q1ÍvUSM] KxvAQKy[ÍvUSU] Kxv BJJBBJKy[ÍvUS]M }ht49a0|\st lt0JwtADBCDuPQEvuPQU uC1;y]UEPhMEU WVS}j/W tXƀ>tQv>/uCW?Ãu'jW0W]ÃS K/F>ue[^_ÉU WVSuF thVAN VPS- 6V<PRlj>ɈN0VRPSs[^_UVS]1svF@t9uuhSsVhhh$e[^UVSu] =u9SVӡ}(]0zvPSVh5\Q+=tSVh%5XQ+e[^ÉUVSu~th6VV9Ã=uGhS}2=u)N@0uPShJ5\Q+=tSh[5XQ*e[^US]{thiS.{thSC $fCSsÃ=u5S(}%0"uPShJ5\Qh*=tSh5XQG*]ÉUS]{thSzC $fCSÃ=u4SK}$h0tPShJ5\Q)=tShǣ5XQ)]ÉUlWVSu} =t=u WҢ}uA=WVҠ0sPVWh}=WV{ÃEPVu3}t-jVuWV8ÃuV  }C00MsPVWh 5\Q(1NEPhM17v=t&VWo}ufPht5XQE(e[^_US]=u=jhS1}&0rPSh5\Q'1#=tShȤ5XQ']ÐUS]{thܤSC $fCSVÃ=u4SW}$0rPSh5\QK'=tSh(5XQ+']ÉUS];s'St xt@u C;rۉ؋]US]v#St xt@uKwމ؋]ÍvUS]u h<5\Q&SHPhK5\Qk&0s&PhU5\QI& Ct PPhe5\Q"& Ct PPhw5\Q% Ct PPh5\Q% C t PPh5\Q% {uPhå5\Q%shӥ5\Qp% SPh]ÐUVSuCFthSF thS̝FthS赝FthS螝FthS臝F@thSpe[^UVSuV1ۅttKrVh%5\QC$؍e[^ÉUVSuVh<5\Q$5\QFy BHJȅ}RvtE t2BHJȅ}R謵 v uăytn^1e[^UE Pu5\QY&=u=hF u(hLu jÉUWS]߰QŒtSP< vhj 诖=| 1e[_ÍvUVSh=lh]S+"5l Džxx@PjjSFP踘0tKhS5l胖~*| uRS5h jTUWVS=ph=tP蝑pu-=tPhjęPְtuhij賕vj@5 Ãt/5Vu jtC vt0h(脍Ãu,hhlSVt0p@PhT%0}V5h5v5h`5\Q?  E=~EE]u}E}~"jShh51 |΃jShh5E jVjj5 }hOEjWjj5轕 } hOe[^_ÐU WVSu>t[Àu5vSyvN4%u_t-tWh21 F>ue[^_ÐUVSuu VhЧhSh SVn[^U=huhܧhߧChÍvU,WVSu hj]SSh ƃ |819}0v)PEP5菒Ãa9|Ӊe[^_ÐU,WVS] ShjuVэAPV5 SEP5he[^_ÍvU0WSuhj]S=߰эAPS5贑e[_ÐUu u5蒑UhAÍvUdSu uhjP]S Sh]ÉUVS=ht12vhh z1CFKve[^ÉUSE |3PuhhS* ShvÍvUWS] ߰эAPS5p‰߰эA9tEu e[_ÍvU0WSj]SEvEEEEEfEB vPA0]EP)DžDžDžPRPjhSÃ0uhvcDžDžCQRjh Qh7jSЃ th"S1#tT5lPR7 5l uQPh@ RwP PBЃ CS@1[^_ÉU WVS}]=|uh`G|=uJj|@P! tj|@P uhcjY$l5|N}}uLEP`Pu+<t t `<`CLG}tR}uLEP`LP踘u-<t"t `<`N?5|N<uEE P`LP7u$EP`PTNyf1;5|V1<uEE P`LPǗu$EP`P觗F;5|r15|Nx0EP`P^uGNyՋ5|N vN|5EP`Puԡ<uOƉ_5`FLS5`t5t 5t! =`GL1e[^_ÉUS]tHpt?3P"t-j.3kt$35pu Yv[;tL35pt׃j.3t35pt;u1]ÐU WVS]}ujVjjSU  ujVjjSt E e[^_ÉUSjjjC1IYSrduhj&jSPdEȋ]UWVS}] 1E.u.Fu<.u~uF/SWu볉SWڙt߰эQэyE@=n{uWVCPD;/WVDPuED؍e[^_ÍvUhE PuntUhhh5\Q8jzUVSu] u#13h*3Vt;u=h%e[^U WVS]u1;nu{ou h1؀8tv8,uF@8uPXoǃuhi11؉ @Fj,P]ue[^_ÐUShڮhܮ;Ãt6u ujNPhS S1]ÐUWVShhܮ^;uU$8u1 hܮhj1hj􋅄Pb1vDžx觝<#_< W< OhSƃ>hSt8uPhfhSRt8uPh3vj PVNǃt 8tVh vhlÃ;hPCPƃhPPƃǃ PhcP9T􋅄P聖h[^_ÐUWVSh!hܮ8Euhܮh#E5xv~FEt2CPEPގu߃PWǎu;WEP6hEP }tWEPh5E]EPq}u0hܮzuhܮhPj1ve[^_ÍvU WVSuKNj5xt|W^Su]} tE PPύu=}t&PSi} u`Phj3hSZuWLke[^_UxxR#kxuUE uPuhjUuu uÍvU,WVSDžDžDžDž|Dž䍽vǃ<$5$Dž5$~Dž5$FfDžh5$|Q' Gv5$|P#vWSh5$ +vhM QEPߓ5B;EtM Vt SSW |Dž tDž vDžtt unPVruVhjGvu (u ,u$fPhðJǃtlhðJtBhðJthɰjG+JQhðwJǃthjGv|PVQbu}ShjGvjqUS]St@QCt'=wB%1uքuQxvQhjC]ÍvUS]S赊t@QCt'=wB%1uքuQ5xvQhjC]ÍvUVSu1ۺ<wCjEP5$qƒt |E8tVh%j@De[^ÉUh@hh߲5\Qj@oUWVSE Dž\8/u Phh`S詸EhSd1XuShjBv11\0]TE,]8E@]DE쉅H]艝LE䉅P]ÄN4UvSvN4>F~e[^_ÉUWVSu@Eujju>nu~ou EEj=Vt@] t[װэyWRVuԋt<=uDžt'U{ tUE;Cu[ (C!v=uVh̴jv1hʴV ƃ'EP_e[^_ÍvUVSUM ΀:t"YvB:/uz/tBـ:u)~y/u Av[^ÐUtS] Su.t3EPSRiuE%f=@t1Shj@舍0>PShj@v]ÍvUuu uÍvUWVSu] DžXDž`Dž\}XE`T\HdPhL7$ȶ`xv`lv``v`TvTPWhp5$4v`(v5$JoEXhSV8P5)ƍth;HQsWW\E}E`E }uRW;Eu$Xth :"EXtPh_"PPhyj?ǃtmhy(?tChy ?thjG>PQhy?ǃthjcvEP\HQLPi}uhöj"jeUh5\Qj@eU<WVSjuƃShc@VDhǃuVe{C)ǍWdƅ ЉPPhcVgÃtVd|> vIx)Dt|Ȇv[^_UWVSu:Eujju>nu~ou EEj=Vt@] t[װэyWRVuԋt<=uDžt'U{ tUE;Cu[ (C!v=uVhljv1hjV,~ƃ'EPYe[^_ÍvUVSUM ΀:t"YvB:/uz/tBـ:u)~y/u Av[^ÐUtS] Su:t3EPS^cuE%f=@t1Shj@蔇08PShj@v]ÍvUuu uiÍvUVSEu ~a6h=t 3Ph;uhwX\#h\h uX\tPvzu;uvhB+X\SvC t8tPshU sh`^u3h\eCL88e[^ÐUVS]58u;8=,Nu} u 8=t;Xt8t ;Xu8uSh踿Ku#=\th\phU]vph`]u858e[^Uh۸hdjÍvUhhdjÍvUhĸhdjÍvUh2hxX\Uh`8hTX\Uh Ih@0X\U WVSE}uEU BBE}hfE PEPdt(}hqE PEPBt}~!E 0hX\E XxPguX\E P9t9XuPE 8at=2tv}tD=LRtE p)‹E P=WtE pH+‹E P1ҋE 9Xu9xtRpE pVcE @9t POTe[^_ÍvU<WVS}>hE PEPu"E 0h\X\E tR@Ih\j\hX  =W>u@I=@IVE 0ɼm=d\C;t1=vPB N4%t΀;uvtb=vPB N4%t)=vP0 N4CGu=LRtS'Ã=WtS4)Ã19u =@8uPSV=2tPa=@Iu>=Wt5@8@8hغhݺdt@I@8jju 覸ƃ=Q;uv=8=@IPE 405=LRtE 4d&E =WtS (1ҋE ;u =@8uRSE 4=2tP_=@I=W@8@8hغhݺ+t@I@8iv1 󫍝Sjh E 4!u u'E 4h4S- v=@I7E 0船=LRt7%v=WtS&19u =@8uPS7=2tP~^=@Iu>=Wt5@8@8hغhݺ߸t@I@8t ?P,F;uPj_X@I[^_ÉUhju u4ÉUR RtRju uÐUWVS1Dž}uEU BB}hqE PEPjt(}hfE PURHt}~E 0h+vE HPPkuX\16vE H=d\XC;t5vR~= N4%t΀;E XtbvR0=vN4%t)vR6+N4CFuE PtD=LRtE p!‹E P=WtE p#‹E P}PE pW}u;}E ph&t04RR3vu,jE p tf9 | DžRW1ҋE 9Hu 9HtRupE ph0MhRR 9t PK[^_ÉUVSjFXQBHJȅ|  Rj B5XQ5=@Itl=Wtc@85TR@8TR5tRhݺ脴t@85TRjhX@85TR@IjhXkvUWVS}>h5E PEP蝰u"E 0hBX\ E tR@Ih\jShX :u@Ir=@IcPE 0kD=d\kGÉ=vP9vN4%t*É=vP'N4؋Fu=LRtVSƃ=WtV ƃj1;u =@8uPhPVh0Ve =@Iu>=Wt5@8@8hZhݺ/t@I@8j5Wu mPRjQ@I[^_ÉUb}t_ÍvUVSlRt+5HIڃufRht hS=WuKjd=lRt5HIh= vhŻj&58Wڻ8tR52Ph 5D8Ph# 0h Ih`8h\h2h@  58P5@8P5DRP58PhR 05`RfP52WPh!  525Ph  5t\P5d\Ph"  =LRth2h@\h?  hY{=Wth@Nh@Xhf| h~G5RP5W5(NmPh7  5RKPh۽  ؃=DIu=8tP58Ph@ 5`\Phg 0=8~=h~1ۃ;8}#3Vh C;8|X\e[^ÉU WVSEu ]};ƒ_vu?h_v说u8hbv萴u 6h !t3PWh e[^_ÐUhhDRu u5X\ÉUhh`\u uX\ӻÐUhƾhH8u uX\ÉUSE] u=(Nƒ(Nt3hlvh_s耳tkhbsiu(NRj EPsNƒ~E8tsh X\gW(N5(NPhA\ =(Nt5WhW=hm |(NX\]ÉUhoh8u uX\ÉUh|hRu uyX\ÉUhhRu uUX\ÉUhh@8u u1X\ÉUVS]u ~6h=2ƒ2uOh_v迱u2hbv蘱u2urj EPvMÃwE8t!vhX\8t P>AShh8{hvhW2W=2t$t8uh &2158ڻ8tR52Ph2X\e[^UhWh8u uYX\ÉUh`h2u u5X\ÉUSE] ~3hh_su ,Nyhbsu ,NVj EPs?Kƒ|E8t-shX\f=,Nƒ,N=,Nt HR%HR,NPPPh=,NƒX\]ÍvU}hE PEPפt}~E 0h4X\bE phEu8=X\u,=8th wE phIEu WU WVSUu  BFt6hQX\~FP]uX\vveL}"vh&趥X\LvhStShlvhhX\F9t Ps=[^_U}hqE PEP#t}~E 0hX\E ph DÍvUS}?h5E PEP辢u#E 0hB!X\E tR@Ih\jEEhX ;u@Iyv=@ItmSE 0补tXSh@C=@Iu>=Wt5@8@8hhݺUt@I@8jju 藢ÃZEPjD@I]ÐU}hE PEPst(}hE PEPQt}~ E 0hX\0E ph9BuE phBUWVSE] @C@C~3h3X\3'1t E2uE-CEƉ׹1t ׅt"CP趤uX\CEƹt<8|t7CP{tsh7pu X\0jjhssEP1V 5XQH$C;Et P9E9Et EP9e[^_ÐU WV}h5E PEPet"}@hfE PURCu$E 0h`X\vMU DEEDut2E8|t*EP@tuh75tE ƿ1tҀUtR@Ih\jAEhX vuEwEajjEPE 4u-}t2PT =@Iu>=Wt55@8@8E 0hݺ_t@I5@8G=@It EH9fEPj@@IE;Et P7e^_ÍvUWVSjj@jj@ǃ fÅfS@C~jjn@jjb@ h"9u Džj/PvÃuƅ-hCSPE޺1t tƅ+=,Nt Po5XQ  }~(j5RhWP- jWPWhX\j?~V9uPj>Wj> uh藝X\ vX\[^_ÍvU`WS1}hE PEPSEv!E 0hX\E ph9<}hj‹E PEE ph;uy}X5XQh5XQ. 5TQjO]SډװшD E X EE p h;thm'u}uE p hG;lRe[_ÉUS88h$;u&=X\uh@mhi:8]ÍvUShStShnvhcX\ÐU}hE PEP3t}~E 0hX\SE ph:u8=X\u,=8th#lE ph9ÍvU}hE PEP菘t}~E 0hX\SE phy9u8=X\u,=8thkE ph)99ÍvU}7USUE 88puP78]ÐUSUE 88puP68]ÐUSUE 88puP|68]ÐU=lRtjj5ji=lRtjjj8vU=lRtSh6@bt PX@blR=Wu 8UUE ~0hX\*u@hPhf5Ujܥ=Wu jh=lRt\ \jlhjh8}U WVS}=hE PEP贓u!E 0h%X\E pzEu+h8f5XQUX\q}u hLEx u+h^zf5XQX\,h8gtX\hyj6ÃjIg Uz tM=lRuDhe5XQ! j gSj5X\hvh`Ir;ƃ~)`Iװ)QaIPRgE PEHPUBЃ=lRt \ \jhfSj5e[^_ÐUhyhd\u uX\ÉUhht\u uX\ÉUVS]u u%LRhdLRX\[LRPLRУX\jvh@\ P\u 2jvh2 2e[^UWVSE2=2tEU<t~];tk@\Ev11ҍCE}t? :Mu;U}.2$B@\t8u;U} 2FuF];u[^_ÍvUSEu)WhjcWX\vhE PEPt}~!E 0hCX\WX\j 5RÃ=WtC; tRj SњÃh5Rh@X9C; thSh@N]ÉU|WVSu@XEEEEIyU:t}twMv$t\uFG8tEb0~6GG8t(ωEt(܍UFt8GuE4G v:t1ۅt>tF?tG>tuu>t UE@N=@NPv1ۊ[t3$'v\G vG?$G=wB%1G?0u UG: vBF:u  E PEPat}~ E 0hGX\;jE p ÉփutVSE ph[}X\e[^U}h>E PEPӆt}~E 0hG0X\LjE pdEt)EPP PE phcEX\ÉUE pq}~iP['ÐUS] hjSu^tsshx]ÍvU WVS}h>E PEPЅt}~#E 0hG-X\E PUPuX\h{!Ãu߰эAPcǃuhj{vShWq#(N588(NjjhE pWh0<;0W(N58E @9Et Pe[^_ÐUUE 02خÉUWVS}IUZ11ۋM8tSUvR vN4%@t;\CM;CF<u;:P5RE  }  M:I9vװэAMIF9s38;u%CװэA9s8 t;s;r9vLPRSS5RDu[TXQBxz|  Rj hjEp0*UR>[^_ÉU WVSE}эq=tHvװэA9w&VREP跍u3EP;uEPu EP4ÃjEPDÍe[^_ÐUWVS]j/Suƅ.ƅI9uƅ/ƅ$)VSS P0u DPs 1t Sֿ"эQC9wnэAPRPu;Ruuh@jsvPPPRJ?ÃP4Ru PAà jRKÍ[^_ÐU,WVS}DždDžDždDžj/W܂uƅ.ƅDF؀8/u9v K;/u9w)CSWPƄ+=Wuh P;  tjPE @IDžl=@Ita;u@IPj/St@v؃PyuhjwvP5 UWjV~ÃutPh]vPh t%W1nэQэA9w@эAPSPuSP~F ;prPu PÃjPÍ[^_ÉUWVSuPNj_)ÃS7h`Iƃ`I)lj`I\\l\h8li8E h; l\u3l9u*Px\4hu E(58x\l\4h8=l\uEPR x\0gƃF EǰэYl\9vJ~8ETvRK N4%tl\l\9F D/wq$EPh%U=lRthVN8vEPhC%EPh%e[^_ÍvUWVSDž0Dž,}.hE PEPyzuE 0hbvDž43 v44;8}j SE puы4; 8u#E phxX\h`I8S!4((4 3;3vC;|,vR^ N4%@uξ`I;<$t<\CC=wB%v1tZ1M v|PC=wB%1uKA9|kE tV E |8{iuFDž,C0;U}5E 4VU E 0<эtF;t C; dx\0OdǃuhK=X\uhwKX\ t&=lRuhLKX\=8th`I&Kx\05RGЃ=DRt8t2XQBHJȅ};B| Rj8Ph`IcREx\E (439t C9,t00;U@[^_ÍvUWVSDž|DžT1DžPEP`uh jwjhC`Rbu`\NjhK`P2u`\`QhRj~wj/\P{ƃt>u URh+ Ft>u MQh j/VQyXt@XXt X8u URh } M QTuh@jvjhCTP u T9jhKTQtE Phe1 T\\t \9uE PheF/j/\Rƃt>t`\9[u)j]QxÃtC\C<:t"1j:\PwÃtC=,Nt XRVS\Qh tڀ:uI}1󫡌EEtPEPR\PËtPtWSP\Qhv ^<0{P\PhUv }tStp pp|| u't@tuhuF=dR8tt[t B9Cuu8ss|PfuBt@tudjjjj]Wss耭 Whottpp|P}Ft@tt|P\RhtGvPQyDžPTu#EPhJ\RVh!vM QEPh2#VhJpPFd d| puh^dRP|P;d}&h|5spO  fvp6 |1󫍽|G|9s(jW|P< t< uƅ{j V|ǃGjhW]|tWhG|9s-jW|P%m< t< uˀ uƅ{|=vPN4cujhWztG?u?ttj W"{lj lPWDXR\R\R=XRl8vXR\RhhXQwzh}XPhqEDžxh\]t&xxPj hjxxR|RWÉj=v |LdDHDHxR |RL v)dǃd~'dQWhPuȃ=(Ntk=Rub<XQBHJȅ};B| #Rj#)W֡|R9 u;xRv5XQhLP|PEd=(N=R |R=xRW9 u;;xRv3XQBHJȅ};B| #Rj#QXQBHJȅ|  Rj %5XQ0dthnj6t=8th?xPj|P hPTtTR5`Q#1h )XPhm\Rh`n|t|PSTtTQ`PPtPR([^_ÍvUj|hz> 5XQjh\诶vULWVSEhWXt!=lRt jjE@,vhj h(j  hhDž }vDžDž1DžEU 4suhjkkvjhCPtu'RPjhKRtt(PRpj/StƃhS s t]t3Ft->t(j/Vkt@ 1=,Nt(RVWSPRhb hS%$Shp=lRtjj`E]Et?t}E=8t 8EPR`=8lRt#uAPRS6du#Sh@iE@vjjhEdEgEEPj=WDž1=8tUt>thiVNpt*8thiP!pt Džt8>t3u/EduEEPj$=Wt :uDž=8u#PupPhq;t*RVhhSR EEEu t.@8@8EEPj聴@8EPjF X\Q)ƒt E@RE@Eu&E;E}j:EU 4*pW=lRtt jj[^_U$S]jhKSFotkjhCS/otT;[u#j]Sgtx:%4vEPSjtj:Snou1]ÉULWVS];[uPj]Segt>߰эAPCPh߰ѸD9߰эAPSh\߰ѸDƍ}1EEEEPEPu V-ÃtPShPVhe u+0PVheX\`v{thsV5HISBs ssFǃ }%[uփhMdX\=dRts8tS9Pt @t 9PuuȃppWƃu5[tWYhc5X\]ssWy{jjjhQss| Phec[jjjhQssB0PhW hTssh]AsDž Ph ]WI}"hbX\?v=!]u7DžjPjjW }hcbhW t]hW @b =t]tuhc1=8t5HIh|j~7t]t P1#@bt P#X\MDžjPhhW* }=,Nt h)maHI W1[^_ÉUjpXQBHJȅ|  vRj 5XQ=tjh@]胪vÉU WVS}=,N5XQh4u jWh:[j u5XQh@9vjWhJ,ju5XQhPZ VW:1XQBHJȅ|  Rj }5XQ=@bu h``X\1hܮjÍu VW5@b 5@bh5@b2 %P5ƃ=tt jӃSjue[^_ÍvU,WVSDžDžDžDž@4hܮj%DžX\Dž1Kvt]BHJȅ}R v~?vt]BHJȅ}Rn vSh:t]BHJȅ}R2 vShhh5@b 5@b.FGuJ}C=8th.5XQX\v 8~r5ui~d=\t$t uu5HIhuXQBHJȅ} ;B| t vRS25=wB%1tX\DCУX\tbt!tdX\vDždDž=wB%1t^Dž t#)t?8s@-Džv~(u Džu-ut X\uE9sFt]BHJȅ}R v 8~H5u?XQBHJȅ|  vRSJ5XQUu4+vSPh@^ƃ@^t(X\;tv1t 2Qju=X\t u @=t"ܮtt jЋ,v QjX\1[^_UEU UUBRjjPj gÐUji@Ih* 5XQjh]ˢvUWVSWEUPR2DžxR|RXR\RR=8t?}t9} tU :-tRh7}tMQhB=Wt]SE PURh.` vL898tjPDžDžDž|DžDžxh]n=2tj=2uꡀ|PptQj|t|Sj `PjJhjhpjtu N1t  uTQRM 9|jj |h] CS u7ShPVSj |Pj aRDžp vhM QKuF] ShS-VPjd RjPX\ Dž EPAP{|E%f=tJ] Sh]1Pj Rj􋍐QpEЋUԣXR\RtRSjPj |t|Rj gX\h]sR Ruttuy8uj5RP81|-(|#jR RQRAP}2] ShSET􋅐P RRSQh~5uwDžx}MQ]ShPjRj |t|Qj g􋝐SPMQhPtgSjPjq |t|Rj T􋍐QxPI$jzXjj | 8/R1txR|Rt)~VSAPǃڃ=(N=Rt =\RE|R9fE9uE;xRwTEXQBXZ؅};B| #Rj#!WEUډEU덃5XQhtPBP8ƃ=(N=Rt =\R |R=xRW9 u9;xRv1XQBHJȅ};B| #Rj#AXQBXZ؅|  Rj 5XQ }E PhSxP{X xE9uE;xREXQBHJȅ};B| #Rj#}5XQWEUډEU=(Nt#=Rt =\R}E|R9]C @CPSЅ};C| Sj xR|RBHJȅ};C|< t RVxR|RGX_؅}􋅐P;0t=(N=Rt =\RE|R9E9uCE;xRwE3XQBHJȅ};B| #Rj#XQBXZ؅|  Rj 5XQ@ @tU RhSMA @t.8 thMxR|RjuSt􋝐S҃􋍌Qj[ SjPj |t|Rj |R=xRj0XvQj?Sj. |t|Pj =2uX\|PNt􋕌R jHX\tt􋍐QӃ|R u=xRt j6WRRRX[^_Uj[@Ih 5XQ:jh^CvUWVSE lDžhDždDž\WEUPRxR|REXR\RRt 2pu%EEtZ=8tQ}tKlt(}u l>-tlPh7'}tURhB =Wt%EtMQlVEPo Dž`DžXDžT1=t\u E%Eh^芓=2tj=2uꡀ|PXtXRj\t\Qjt5Rp2X\h<jXhpj\ }u*lNl:|jlQjj/lVvJ8t38 t)VhSHXPj tj;lttlvPƃt/}9lQhSIHXVj \P=`Rul8 uUhlRY}:lQhSGXVj \Pv=`R8 lR#lueXQj\V=`Rt;lP"luXRjv\Q}Eu=8tGjj6L898tjP複juVIXR\R\ t4XPj\RjX\ vh^ Et3R Rt&RRRPh~r }t$URMQhKtC URhP+t#XQj.\V vh;d }lNu%XQhR2l:|uajj ThlCSvh u ShPKR2Dž`p BMQlVhuVhSD Dž` EPhBPO|}uE9EvUt Puu!hTDẸE%f=tR2jI8Et7R Rt*jRRRPhBP<x 1vؙxR|R=(N=Rt =\RE|R9eE9uE;xRwSEXQBHJȅ};B| #Rj#WEUډEU뎃5XQn55dBPÃ~'S5hAPaƃ9=(N=Rt =\R |R=xRW9 u:;xRv2XQBHJȅ};B| #Rj#}XQBHJȅ|  Rj Q5XQ\}.8 thAxR|R9_}lV?lPhPB0vER RjjhRٟ|m=R~DhCHKȅ}hPJt' uFF9|ÃjjhRl}UlQhS@t5Rp2`hR`vd uE@E UdzvE9uE;xREXQBHJȅ};B| #Rj#i5XQtWEUډEU=(Nt#=Rt =\R}E|R9]xR|RFPVЅ}dQ  uEtVh@ @@HhJȅ};B|h hQj {tQtZ -hBpr}h;A| thvRS&xR|RGPWЅ}dQEt!EPh ԛh` =(N=Rt =\RE|R9E9uCE;xRwE3XQBpr};B| #Rj#AXQBHJȅ|  Rj 5XQ dF @t.T8 thj=xR|Rh@ @tlRhS3=jBt Rp52`thP`҃XQj$\Vj TtTPj dRjr|R  E u=xRt j}G=2` jMQ?xj|SxEESlV lxPPaPVh9@tRp2TtTQj jj=2u4X\XVj\PjvdRX\|P`ththQ`փdtdP|R u=xRt jEXRj\Qj8[^_ÐUWVSDžXDž|=!]u&(]f=tf=uh;DžP]=D8P ]jj]P}h9 =dRtS8Ӆt ]9JtvRt 9JuuڃrrP+uhHRt5j|Pjh5 }h %9]t,=DIt{8=,Nu 8DžTTP85X\gfff)ƒu%th@ DIDžTklDžTTQo5X\gfff)ƒuth@g t:DžTpTRthu.Tk X\gfff)ƒuthtxPRUEPEPEPRhh@4[ǃ 1UE E E †]cTpa X\gfff)ƒuth]ttxPRpPUEPEPEPRlPhPhh@4gǃ0 hlp1UE E E †]HvtxPRpPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRlPhPh@h@4ǃ`hlp1]UE E E †]UE E E †QUE E E †QUE E E †Q vTDžt X\gfff)ƒut hdgPtxPfPePVhh@4 ǃ uLdF8u?F8u8F8u1P]CtCC"thftfx Іf]]PPP52hP ]=Rt f]t Pjj]P‰}h2=Ru/j|PjhRB }hC=]uG=2ƒ`j`Pjj5 }h ?2=]uG=2`j`Pjj)5 }h 1]PPP5} hsHRt5j|Pjh55 }h 1Dž\\Ph]5}hF1vj5}h?1=R=]u[=]uR=]uI9]u5EEEEE]fE]EuP~udF<u<uFjjjj-]SPVci t&F%PSWhFhNFt t=VAPFPBPBPBPFPhV }VAPFPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPFPjjh`u"=RuRDžX%Xt R=]u9Dž|j|Pjj5 } h.13v5nXt R8[^_ÐU0VSu ]E=D8EPEP5Ã}+h>.51b5=]u1EjEPjjS }h-V58e[^ÐU|R u=xRt j8ÉUj4=UWVS]hjEt%=W@ EW#=WE@ WlRUlRHIthPCPţƃCM HI ]󥿰]u 󥍻 ] ]ut]<U<t]@b@@@bL8DDL88HH82LL22PP2`RTT`Rd\XXd\LR\\LRjh@\`PwƃpE`Ph@\" jh2qPAƃEqPh2WMW hh@XPƃEPh@X hh@NP趡ƃ EPh@Na EPj=tjUҍe[^_Uj:XQBHJȅ|  vRj 襹5XQ谬p]@Ijh@]svUWVSDžxEuǹut=`RttL8u=2t=p\t98tjS+j=DIt(ht DI=DIu'hkZthuj=lRu&hMjoX\98tjSih@4h,u[h@]rhjxEPEPh t"xPjjjnxjE@E E PtPh2ujjjl jxPj jAEPE Ph4hjju1t t=Wu j%vuu=Wt j=2u-Eu3E PtPh&\jv=W%PO=2Eu|E PtPht\j=2t jj=p]t X\xPj v=2t j=W%P=2h|SSt]Pу j S *}hJ%=p]t X\ jajW =Wt jj=p]t X\xPjuX[^_ÉUVSh]S$Rލvt]Pу jV6Ã}!hP$X\ vtj~h[^ÐUWVS}j/W &EE1tj9t t Pƃt/})WhS$1h`g1Wh))эAƀ).)}0uC<.uC1CKu9E}dtEC<9uE0Ejh)ƃ})e[^_UWVS}=@bu0h/$=p]t X\, tvhhhhSa jjS@b@P貈thJ"hh5@bP5@b< hSOt]Pу tWу j S*}hJ="=p]t X\"t6Gt!hPGPju=X\(u jjh[^_U$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPRrEC]ÉU\WVSEU DžDžhjGh\I8hȺà tShh8=8uhh88@88D88DI228R2`\RT\Wnx\h޹pRu pR j/12!Ãu vCÃh莹th!Pm't D8޿$u D8޿) u 2h2Wt8u W=2t$W8uh@2hɸÃt޿u 1ۃTQ@P謦Wt8u `\XQ@PvRB̃B$R HR,N`\8}@8q8eD8Y$h\MdR $5H8)288 hPRƒ5) 2Wt\R=dR1󫡌DžPPjP薗ÃtQSіPRh; u 05Ph j 8ÅtSuPt qPoj+hj j:0$tN􋕼2,u7RQP7PvhWdt jhj1h(j "` ~BP)PZ*hWc؅t"hj菻h(j 耻 S+Uj)jhWcUj)=lRtl@bt*j@P5@b@b |&jP豼5C lRj=lRt=@bt*j@P^5@b@b lR\jÍvU帴ÉUWS}==`\0XQBHJȅ|  Rj )AE< uqv=hTQBHJȅ}RE EE  u\\EP5R\ǃt}ujj譀EPUЀ<8 t=vh%`IuWSEWj5T\ =Rx\0hÃu h'u h{ t=lRuhrvTRx\05RCЃ=DRt7{t1XQBHJȅ};B| Rj5{=`\|=Wt%5XQPy5XQ  5TQhh`Izujj`IװэAE{hj`h(j Qe[_ÉUWVS}u1z11E tLEEUA8Eu:t;BA8t:u+E9~ Ǿ]9uF u E [^_ÉUWS@R`I2RDbx\@RRqÃS5x\Xduݡ\\=`Iul\80vt)Rl\x\|I 8e[_UVS1@R2ي jU|WVSDžhuÃuz߰эA=v#j?袈PSh1SvSh|hShSht-u/8tShD먉hSȬ}ƅj.S{6Dž'vt tDž h.URh.5HIj.5HIƃtIQVdu2HI)Rh.Pu+5HI.8j.EPyƃ8RV+]Sh.MQ. t vjKU u.h.襆M jhj h.P[;E 0t t-P-@P葱| ?iU:h.Mh3j P-@P| ?.sE8gh.腅UJhjr =Wov-BHJȅ}RF vt tǃ tƒt uh?v83316Àu*vSW N4%@u:FG1-BHJȅ}Ru t@v-BHJȅ}RJ vX uÃJ8u- 3978V38vD3@ 3 384It`-BHJȅ}R v< u ~fFIuIu#hOh.hi t: t5*h h`J5-h h hK h>  5-x[^_ÐUS-@ `r -APQЅ}QR v8Bv t,t."u{7\u. -APQЅ}Q C -APQЅ}Q"u..9v\u. -APQЅ}Qe C -APQЅ}Q4t t t t,u=.u 1;C6v=t h.3t҃;u ]U WVS=lRt5HIh:}hE PEP-EPv!E 0heX\ =2t8h\~E p=2t(Wt:uhjPR PE p蝡=2t>E ph*蒦n=8t5Wh@dlR8DI\f\jfCL88`8ll`8BABfAI2vv2BfABAhR} I$IWf\R߃=8tjjE pk58=,Nu 8hRuetaEj hD^oÃuj hD^WÃt{.uKEhD^hEctEjhh@^uu^=Wt p\ 2L8\BfGBGtaWhbQv=Wtp\ v2t(j hh@^u hN58e[^_U|WVSDžDž} u8PEPE PEP}X\1} t }+=R1Df@NE u&Pu E MvE hP蟠u hWhS ]E M ۀƅu虩Pt0tVEPh[vMQhja5TQjO]Sh߰шD }uu ] E jPhvdup}uh~_Euh3u?Džuh[_hu)u2t(Phơthm=WuhlR11@;8}E3uݡ`ICfdIx\05R_x[^_ÍvU WVS`I֍^vh$uh0_ƃ`I 5TQ)P`IWf u^э\ ~C`I uƀ`IRM;ȋEx\E ȍe[^_ÉUWVSu}=@IuA=8u2P6v=8u7=2u522P2@2=h5pRhhS S}Sh61vPס8t 8 8(N(N} t=W%PN#jjP6Sh% *>uۋ X\Q)ƒt t@^} t=W%P8(Nh,S)cSǥ =u#uh@Z@5hh.hcu5zj h. t.[^_ÉUS]=@8=TRu Shg[5XQҀ 5TQhPbu1{vRtvN4ntat#9pu3@8hoTRSh$[ÍvU@WS]=8t`}1 }Wjh 3fu}u3h-Wr1E0ouWre[_U WVS=8=,Nu 8uhupj h@^)ƒttBj EPR<)É֋E8tUvRavN4%@u*} t=,Nu h@^=8؉e[^_ÉU\WVS8E X\ME=,NuE8uh}1 ]Shh@^Ӫ1߰эY1u)jhMQVu vutdEPEPEPEPEPEPVMQT u:EEHEt EEMMEP,VE}u$} u =,Nt9MQh!XX&EE} t=,Nu h@^ M 8}uEX\Ee[^_ÉU=u 踞EPhwt@j@t9Eu jÉULWVS}u>jh2藝2222RR22jSW=R\R=XRxR|RRRȉ XR\RSQRP³Dž}1d~dWhEhSRƋ \~VQ)ÃhM)Qh`Sh)P.Pƃ 1ۋC  u vvB> u P>PQRh)P.Prƃ 2)‰2)ȉG}G@Bv29u`;2vR2222~2G2Dž2)‰2)ȋC}C@BG5Hۅ|R=xR\R9u;XR~؃hXR\R+RR-xR߭ٽff f٭߽٭u9?~v-؃h)P.PdƃjhRP肰t Ph+ vh0)P.PƃjhQR\Ã<יR)Ph4)P.Pƃ VRj-}u hj蕖j D}ut8tPb~~PfPh@>ÐU WVS}u Ghv\uhvEt^l=lts3hi>;uhr>jd hhhivÃjhvڇÃuvhSC tvtV.׹u (׹t h@\vCt$PC 8tRhz=CjЃthJ=1vSKt vh5\Q 1vCtvЃs 3hwNFǹtP ƒC C PP3h< kSe[^_ÉU WVS} }hhwuhwՄl=lts3hi<;uh;j hhhi;16vVh Vh 5\Q 1 E}v7VÃuujhV%ÃtSouC t1Ct$PC 8tRh;CtijЃ]S0CtjЃs 3hP#vC C PP3h: me[^_ÐU jj"`<jj; jj ;ÉU= tjj:jj"v;jj:ÍvU= tjj :vjj";jj9ÉUEbuh9h914} tˆU "EjjEPHÉUjuÍvUjumÍvUSh $9=t7vCt%8tP3hi vh8;u1]ÐUVSu }t h`hjhv^Ãu vhS蛂tvh5\Q>@{ t&=Duh!L8h?8Ct sv1e[^ÍvU WVS}=tJvF t8~t28t hh 7vh7>uh7l=lv8 tA{u'C PP3h`7 vs Ph"G7;u-v;}E 4jÃjhE 4跀ƃ SuVtE 4h.u u E 4hI61t?F t8~t28t hh w6vhd6tItC8 t>{u$C PP3h-6 s Ph"6G;}ile[^_U@VS]u Ѓ~FPЃ~OPh5~F)vh55TQj2]S<؃ t~5XQZe[^ÐU= ~ƒ ~h<5= ~tPh 55XQZÍvU$SgEPEPH-؃jji|EPEP!- t"=DtuE9EuE9Et d(jf]ÍvU$SfEPEP,ЉUMt tvhCK4hPpÃuVj/Suv@}~jhlh^PSS jPS@ha3jwj EPEP+ t$=Dt}uE9EuE9Etb]ÐUWV=DtJj5|xhg&3 5|+D0@}uE p{ tjhe^_Ujh{hhT:jzUjj2y!ÉUS=t7vCt%8tP3hi vh72;ű]ÍvUjhu{ÉUVSu }t h`XvÃuvh6vS{us CtEvh5\Q^1e[^ÐUS=t7vCt%8tP3hi vh?1;ű]ÍvUjhuzÉU WVS} } h?wÃuwhvSztwh 5\Q~1aS B;Et?3uPRE9C }RRh`5\Q01w wCиe[^_ÐUVSuPpt!vVsu u1e[^ÐUWVS5>tuŃh`@ 8:tjhPj:p =hVWnE ҋэD PhËPVhSm r iY hu:hut p h8h_ h/h"[^_ÍvUVSuV Ãt+Ct PhC t=Ph/vjgáPpPpCPptXVOJCCVHC u HC ؍e[^ÍvUSu^ÃtBStCBCt PhC t PhSg]ÉUut@ÉUut@ÉUVSugu VhVÃuVh 5\Q'Gs8GjIe[^ÍvUSPpt-vs s {t*PhHg,u֋]ÐUM }tPp1B.vt ƒxt9Jtڋu1ÍvUuu1v@ ÍvUWV=D35LphU+}~E pg ]bt\h{+tPhV+tPh6+>Ev= tCu h!h+=th$*>tPhE*at/tPhX hi*~PPhyn* 5XQmOe^_ÐUjhghhA ÉUUBt u B Bv1j.hbPBPz\bÍvUWVS] Dž\DžXDžPDžLDžHDžDDž@Dž<=Dt(5Lphq)qPq }vkkfCh/)5TQ߰Ѹ)P߰эkP 0 mUn TM3h38qָuMHsָuMiָuMt7D$Pu PvLuLMTRhf}PtكD}1EEEpV}WjDPEÃuEVWjDRDÃt^S9DPDQh5\Q  y0APDWh5\Q puYE E SRƃVe t ShW u Shs  vh|O1e[^_ÉUWVS]Dž߰I} I=hSP&P=ulh }W‰t*װэA wRh`nb`nh h`n7c`nh 5 @++<#tHkvR{D N4%@u DžkvR3D N4%@\PPhkuVkPbPE PhkuWkP/vjh hkhhkhk2k< t < t< DžnPuÃSb t5nh Uu5nh :v{ t=Du5nh vhn5mCЃPhhkYt kP{[^_ÍvULWVS}7}-Et*E܃xu M9tUȉUԋ}?}EfeEȋUEԋM M؀9!uAM؋}G} E@EȋU؀:@EȋMAMȋEEE؍]1҉߉E@EEEE܉E̐1ۀ}:t4]vCUӄt(,u C;@u}@t}:uC}u1EMQ}WjEPf4ƃuEURWjMQE4ƃtXV3P}Wh5\QV u!00PWh5\Q-U؋E1E܋@@MȉMȅt ]؉ȃ;EwYu 3}E*B<~#E@+Uu2vM}e[^_ÐUeF+2UhB hU h h 5h 5\QA jYUDt5Shp9uhpt1e[^ÍvU WVSuUu1ۉVE FF‰V [^_ÍvUUJA;BsB@)ȉBÉUU9Bt1vÐUE@ÐUUBE ;B r+BBH ȉBUSMU tQAt+x9| A9}A;Q r+QX؉A;Qu ;ArAA[ÉUUB9uB9BrBB )ȅ}BÉUMQ9r uA9ArA ) A)‰Ѕ}AÉUSMAt9u Q9uA9AvA))Ѕ}A[US]St9u$ S9r uC9Cv C )) 9sS )‰Ѕ}C[ÍvU WVS} utSEP9|EP SWEpZLSEP!)߃ ue[^_ÉUXQ@|TQ@|vÐUu u5|nQUu u5|fQUÉUUX9u 91Y9u= t:ސ:֐P9ubthw;뺐Z9u :막_9u `7듉؁u/U9u 7sS9u 7\vÐUjhtXQ@PuSÍvUWVhjL@ e^_UEHwx$XkYcP[SSUK\C];Q3_+Z#TV^ b1UWVP^_ÐU\WVSu5؁E95  ~P<UԉUȾ@]MMāeMeMeMeMeMeUЉŨvEMQ5|[KEPj5|`K  ~P; wЉ=} tMM=|tMee}ue(ԁ}M~MEԀEԃ}ueM}tMeeEE}uE}tMe}teM@}u EQEteM UtE܀E܀eU܀% ‰U܀ME}hfjLhfjL hfjLh8gjLME nuhj蚥5|b>nuhjov5|6>nuhjCv5|j5nB5|j5nB 5|j5n{B} tn|ك }tn|ك }tn|ك }tn|ك }tn|ك 1}tP5n5n5nFPIà }Cu l8u1ul0Ph   j̋5n|у3s#!‰3 j3 n|4M!ËUhpjP5p5|à }k8#u1 =@tS5pj<5tShp nM|4E!ËUh@P5Dà }j8u1ۅ} j8#tru0؁t'5|,tDP =`tS5Dj<5Sh@5n|у3s!‰3 Nj5n|у3s'!‰3  ~P1~e[^_ÍvUWt p o@1@|~|Dԁ ~(p_ÍvUVS]} t)} 3@u$ukud  3pjhp7pjhp p jhpShht4e[^ÐUVS]} t)} 3@u$tktd$ 3pjhppjhpp jhpkShh3e[^ÐUVS]} t) ~ 3@u$ukud  3pjhppjhpp jhpShh<3e[^ÐUVS]} t) ~ 3@u$tktd$ 3pjhpcpjhpLp jhp3Shh2e[^ÐUVS]}@tȈ t3$t < uu3uo"w8$$=~t ~$39v1t 3jSjI/v jSz 3e[^ÍvUVS]} @t#Ȉ t3$u < 3t{ttAt9= t/=~t ~%FO3€3tjSjm."vu=~t ~%F$3e[^ÉU WVS] ~ƿ@t#Ȉ3t;$t3<3;'ws$ jS%FhKt@D jjF bjSl b A sv1t ;jSCjY-Kv3jS8"u3 jj b jjv ;e[^_UVS] ~ @tȈ t3$u < u:3t3"u €3tjSj,$3e[^UWVS} t8} эA(wU (R,vE $(Eu v>|uEFt<:uU P63EEEE}E|t:uwF}uO))F} tPWU RuE8$UREPWGt U:U:F|tE t} ETہvS #vN4%t%vSu N4FUE9Pu:װu)EU;UsB;UrEUUUr2UE8u9} tU EUE9sB;UrU:u(Ee[^_ÐU WVS}֋] ;]s&VEP3u1;]rܸe[^_ÍvUWS=004t=(t P1hÃtWEPjS uSh!4@t(߰эA(w(Sg) $(4(4oo8u 4oooe[_ÐUWVS p$p)‰ЃPh oj< / pà pt$DX` p;$pO p<?É߰֍~hp9}LhhSjjhhh]S~40WShpFPEjh=` p;$p p<EPEPRhhuujj hhhẺEP3}аӍs@hp9}!VEPhpCPEh a p;$p pt4 t:t tԁ"ԁ~ ~&j&WbH p$p95 p=t4 v=tA|'=tPv p)RP p)RPO p)RPS p)RP p)RP{j p)RPa$p p9Mt( t:0@ @ )RQ vc p;$p p<hmƒtװэA+vjj#2hhRjj#hhhj2UUR}Ӎs0hp9}&VEPhpCPEPj>* h h[^_U} h^;E<hp~*jh8hpvjh:j>*vh 3ÐU}  hÐU} h^;E<hp~*jh8hpjh:j>m)vhÐU}  hÐUM} 9u}ƒC}u ChpL~,jh?hp$jhAj>( h j>"UVS`ԁsCC C ԁrljCtlC  lC jnCtC vC j:CtC vC jCtC bvC jCtC vC ̀j Ct̀C Bv̀C ؀j jCt؀C v؀C j 6CtC vC j CtC vC j CtC vC jCtC vC jfCtC vC  j2Ct C v C ,jCt,C v,C 8jCt8C v8C jFt F b F =Hu' je[^ÍvUHtJu DQRh`ÉUHbtUEuH vHbt PÉUhp ~Q}t#j hUhpjhW!vj hLhphjhNj>#h'ÐUSlԁsmC tY;uCCCtPCP-`ЉЉ%PC ԁrGj]UWVSu} >~Fjj `EVUӁ`8Fu؃h9uE$Fh$ 9uF`Fhei$9VʀhF`ui$<t h ƁhUPBPWE } gt je[^_USlԁsnvCtY8tS hO]ÉUS1۸l=ԁs-P}PPt 8 t  =ԁrՉ[U WVS11E8} uj^a;] }VUt0t)u$tW#C}ljCSt M F;] |tWjOe[^_ÍvUԂthPs!hԂԂu.hԂE'ÉUAt@ÉU WVS]=Ԃt;ufjj SjjظÃu߃jjø Sjj訸ÃuZS߸Ɖ߰эQt% D 9wB9v~Ԃ)׃WRԂu2h]Ԃ )щʉ)щ S~t A7…|'~=u vCut1e[^_UWVEƿ"t_ƿtLƿ't9ƿ/ t&ƿ:tƿ>u v1^_ÉUVS+5Ԃ^}u~ihp9~.S5ԂhpVԂPj>N h{Ԃt'PԂe[^ÐUWVSE1EJFOE(p2$hv(p u9Au0= ~u'= =~$ u(p O@Bu/FOE= =~|$ (vAu3 u.FOE= L=~?$ = u#=~u$ jh {= ~= =~$ (p= u#=~u$ jh = ~= =~s$ "= [=~N$jh 0$(p (p(p(phhhC j v p o(pov= U=~H$jh ShhCShhCS\ShhCS(p ShhCS u !~jhShhCQS j(p+vu(p p= p pvtl p= ps p p= ps p p$p p oShhH}(pB p= p pv p= ps p p= ps  p p$p p oj(ph ~P}t"EPhplEE5phpPǃS}tEPhp$1}u}te[^_ÐU=du1+d`jhj׽UWVSE1EFڊ @uOE==`t*`9d?=dd.t P9u!`jhjZ9u!`jhj~9u!WVjͼ`}v9t GNMÉڃ t ut`h=~tS~9uHt$u$%9t 9u FOE"WVjD`}` ؁= t~9us~+@u$%9t v9u OFEF=ƒjA vtRu`@ tv tv؁tp jhpp jhp`=|u#p jhpp!p jhpmp jhpV `Vu4pjhppjhp pjhphpj~PN}t"EPh@EE5@h@ǃ}tURh@1}u}te[^_U WVS1hp,t2=u$bu= tCu @th 1h@q t =1Ƀ=|uhpEȃ= Ѓ}%PSVRWQKà h@et ÃhpJtn É؍e[^_ÉUE=Ђjjjj jjjj jj!jj" jj'wjj3 htjj#HtP3uf(juju<ÉUÍvUpjhppjhpp jhp~jP jhh9 ÍvUpjhppjhp hhh =tÍvUpjhp3pjhp hhh Upjhppjhp hhh2 Uapjhppjhpr hhhÐUWVSEuh1auEE}EEEE]hp)9|SVhpjCPWj> he[^_Upjhppjhp hhh=t=t jÉUpjhp'pjhp hhhv=t=t jÉUpjhppjhp hhh=t=t jÉUpjhp'pjhp hhhv=t=t jÉUpjhppjhp hhhUpjhpWpjhp@ hhhU,WVS_EPEPuEE}EEˆEMuEMEA}e[^_ÐUS]tjjt jj]US]tjjt jj9]Uhhh ?t jhhh@t j[vU WVSh ^ǃh Éރ ~}t uvS5 UÃ~W=`tS5 j>N9u(9~$)ރ}uV5(ƃ~Sh |9ut 1)ߍGe[^_ÍvUA =~t@tt= t)Cu/=t#9~bt ÐUS]ytP9]Uj$ÉUVSuSvvS N4%t%vSW N4Fue[^ÉUjEPuu uÐU WVS]t;XQt P0tS޿t@hStSh 4Sh5\Q XQ fe[^_ÉUWVS} uEEEEPEPh5軛=tU~ǃEE9s.P ;u*Ph5hC9rԋEEv ~ ǃE E9s!Ph5!C9rEE;XQu hhP5v5e[^_ÉUSMU ]=܁%u+w4QhSQht4t$t1uvt[PQh5'w4h u h Sh5ЙvSRQh5貙 ;XQuhP蔙5hPv]ÐU WVS1E}'w}P7h /w}PE0h }PVh5&,t6'w7hJwE0hJyVhXn'w7hf\vwE0hfEVht:,t8'w7hwE0h Vhr 'w P7h.w PE0h PVh,t6'w7hwE0hyVhn'w7h\vwE0hEVh:,t8'w7hwE0h VhbECFe[^_ÉU\WVSE}E=܁u!9=hU : %}] ;w4hvPh5蹐C$%t# tIvtt&:h"hh h5YS tP@tP}Ph5C tPh5CPh5Տ{u{uCF;u9U Ph5葏F9|sh5q hM AtRt RtRt!Rt*Rh0EP }tEPh 5ՎU BtPh;5賎9vM PhC5腎F9|gPh5d9CU Ph59F9|h5M At_yu h vPh59U Ph5蹍F9| hy h;XQu hK vhQPr9QM J$dvFE <'w4RhVM PRh]5;XQuhPhPhd5詌F9}@E <uF9t0M |1u&ÐM   CB9}< uC9t|tڃ)RE Pj69}hi50ރs;XQu hPhPRh5F9vhm5ŋU Btt E PGPh hM APAPh5sZvh5UU Bt& t*vthh h59>M ttLt't2@E vRvN4%t~U <"tut5BHJȅ};B| "Rj"=1ۋE  BEHBEHy ;B| t 2RQ"U PP5迉F9BHJȅ};B| "rvRj"_U :'w4h vPh5@9}#M Ph5F9|݀}t(;XQu hhP;XQu P e[^_ÐUVSh]Sth W ޅu2|ك jjVjCPUv:j|ك jjVjCP0h ѩuh[^Uj"hp蕩u5XQ5\Q j/0LPh5\Q蓂 hh ܏@@e[^U WVSjǃu40Ph5\Q hu> tF> u+]~ h&]=ԏttjj5؏}300MPh5\Q蔁 h5؏܏ԏ5؏SjEP%|9tS܏0Ph5\Q h4h 19v_܏GW W#Uщ ܏Fe[^_ÉUS]58|‹XSd8]ÍvUM19tt@9t utuhKh +UVSu L9~od 9(9HHBL9|ďHL9H@H L95Lev9|$9~VH@H L95L9vHL~1Ґ B@9|L H u)t jUt jVHe[^ÐU WVS4\j?ЉUP߾[fS=ǃ t+hjW؏uCt WS譮 mfEP}URh1e[^_ÉU؏thP}A}0PhPh5\Q} hh 7؏hPԏ܏1ÍvU؏tPthP uUS1ۃjh`5TQ jjj5XQm -} jďvC~]ÍvUWVSu M]``: `9UN~BNE[^_UÍvUUBHJȅ|  vR[ÐUu u耲ÉUukÐU WVST t uhlh  TEtT8u@TH5HƋ=H;=prvV+Ãt=\tj jvSjjjSEPS %;EuVLG6;=p~1e[^_ÍvUWVSE}uBjEPEu*h hh hGPW8|}U RPPM| TQ` VÉ]څ~ D| uۅeiu5Du05Du}/xECjEP EUB|9=}V5x0*0GPh5\Qy hh  =]t j$P:jP+5|x u,t jOt jPE@PUR5xxEUT:t6|;|2~P8PPK|T8u1e[^_US@(9P5,u|0Ph5\Q x hh  =u)t jNt jOX(, u)t jbNt j@O ,E1]ÐUWVS} ]9tY1QH19щ F9}3 ,9u BH19щ 9u[^_ÉUS$ 9}",<uX$9}%<t$;},$1[ÍvU $(5,, =u)t jLt jMÍvU WVS}?!uh(GP¦h(WKPnÅu150RPWh*5\Qu h2wvE PSƃ} ?!uSv|QSO }@0ٿPWh*5\Qu hIh .vVf=uaP5XQt8+E e[^_ÐUWVS] S1E4E\U;dЉU4\=t850uA t jJjKv?t~U8PPj^ƃu: t jJtajmKUv u,t jYJt j7K]EPÃ} }t*}t$}t}t5\Qhgݨ4v=4t(}t=\u"}u5\Qhy觨=\t=4t }uE}u 4}u U4E \=tUE)‰UEe[^_ÍvU WVSE0v 8uF9}S50 0詼Ph5\Qq hh  =Nt jH+j`Iv80 u,t j>Ht jI0Muu \=tEPUBHJȅ}R U8MA `xU89=}S50 0)Ph5\Qpp hh g =t jGjGv80 u,t jFt jG u0U BUjMA @t?( 0EPh5\Qo hh K}t0U BU40M=\t=4t tHEe[^_ÐU WVSuE8!uh@Pݟvu EP*DP腥Åu4L0iPEPh*5\Qn hVEPSǃ} vE8!uS胡|RS[}@0PEPh*5\Q(n hh 6Wf=uaP5XQm}t +uFv1e[^_ÉU WVSu VE=t ta;u\Wt:_;5du=\t =4uv CSPEPM} 4v]?Fu=tEPUE)‰UEe[^_ÍvU WVS}] uNty=tWPC}|TWPC}?00MPh5\Ql hh s1e[^_ÐU WVS TʍvB< u)΃~DPQJAuE0TU9}S5VP0mPh5\Qk hh  =t jJBj$Cv u,t jBt jBV5T5ND } tNuND } tuDž| t D|8 thh 1^ 7M9ȁ}S50Ph5\Q3j hh * =et j@BjA3 u,t j@t j`A5W5DVs~"MDPRt>mUB9=}S50訳Ph5\Qh hh  =!t j?j_@ u)t j>?t j@UMe[^_ÉU WVSE1TQBHJȅ}R v08EWh9=}S5D05Ph5\Q|g hh s =t j>j>vhD u,t j=t j>DGu \ <{vTQB @tR08Ph5\Qf hh vTQ` T-$fB ;}t }t DDTe[^_ÍvUWVS]} 1EEtuh-MMRv}F;5 ~s5XQh2j=uO=XuFEE; ~8E5XQh@(5XQ蒺 }|B<^w;\t6ʋXQBEHBEHt;Bt bfXQBHJȅ};B| \Rj\F;t,Ph_@t-_hlv%H0XQBEHBEHy ;B| t vRQr$8%H0XQBEHBEHy ;B| t RQ.$%H0XQBEHBEHy ;B| t vRQ; XQBEHBEHy ;B| t RQC}t1XQBHJȅ};B| $Rj$iXQBHJȅ| Rj 51e[^_ÍvUWVSEEU Uhh j1ۋE0эQ~ |r؉mst pt :xt1$0H*|58!a8PPG1ɋTtP*@&D@PLv=L~h"FTvRK N4%@uh"kƅ>!uh"v1ɉTtVhmh>*Ph =Xth"65djd1}gt}GuPiE}Gt}VuE}tZ1ɋT!t VW5p>tP.G ;d @ TT9 gt) t||9w0|r0ptrtdsvvvA TTj hTQ =t=u8"% t4hl"vHt= uh"}et  T8 tx u h #`5 ttL#ƅuA t j!jd"v 9t.tP5 D 5   u,t j!t j!uh h &)=Xt  % }t5 t 4$ T!t VW軾5p5H)#}Wu'#P>tP A;du@=@=}qv=L~h"*1ɉT hK%h ! =ct j@j1   u,t jzt jX !EUT4P u,t j t jMQ5 5PɥElPU1Ҋ Zt j 7jq (t58zGZ8PPj_ ǃu> t j# j 94@ t j _j Me[^_UWVSEE @1;dR蓴EEP脴ƃ ;uGVǃTEF9=}S5 豟0~Ph 5\Q4 hK%h  =t j j   u,t j^ t j< E vWPONM6;uU9=}S5 聞uz0}Ph 5\Q2 hK%h ڡ =t jy twjW k  u,t j: t j  %MfE PMQ} EH85 觯t8PPju4 ut jtjs 뇐@ u)t jWt j5 1e[^_ÍvUWVSpB1;dƋHK19]t9Uut(VǃSơp8 VSjt)1UBU;dPEPju< u)t jut jSV_EU;H}SEÃEP7vUR$ƃSà >pUB8BGZH9E}p)‰EE8=XtW6耸@ u)t jt jb1e[^_UWVS]5H^E pH)ЍpE89 9)Ѝp)ىMWÃt7S[}t EXV8PPjEu9 u)t jt jpp@ u,t jOt j-?N-uE8@P$ǃ1e[^_ÐU WVS} WEPju< u)t jt jG1;dR蔭ƃEHEP肭à =XtV3)3^dH+})dE8@ u)t jt j1e[^_U WVSuuh!h gvE @1;dR迬ǃV贬à 9t5vS;tUR58VFsP|9u1e[^_US] ӁvR N4%uh%h H!|< utE 1]ÍvUS]ӁvRv N4%t4Wh%h 辚]UVSu1ۋ tt-19u ǂACt~ܣt[^ÍvUS]j tCS AQ CA;0uPh 5\Q + hK%h 1]ÐUUE 9t x\uHPR%v1U WVS]1 =V5 ux0uPh 5\QU* hK%h L =u)t jt j1l5   u.t jtjC H9} z<\uC uڡ e[^_ÐUE=tH  P3ÐUE=tH  PÐU WVS=u j茫MI!dPjh)#h%h%艕ƃtqэyA=VA PiÃtAVS|;/t /D;h%S15djh)#S2 j轪e[^_ÐU=u j蛪MI!jhPDUVS]p0K!]Shht@jS|)f}v E Cfv C 0e[^ÐUWVE=t@8!t%ƿ%tj/PethY%h D1e^_UST< uh &h (< tJ TR t8u'=(h&&h ЕvPÃ(t= uP謩SvjJ(u:0qPh:&5\QG& h>&h >Z jS5(u (3vh(h 5(Pr5(贐(1]ÍvU WVSuT7<[t<\t$,CSÃuhL&dC; RC9t< u+=TW09=}V5,詐裾0oPh:&5\Q% h>&h  =t jjw50, u,t jVt j4W5T5,H,T=\u!,*he&h *1j jW5,(e[^_UU:^uB:]uB:]tJ< tDv<[u2J.t :t=u u1B:]u9uB<]t< u1:]uU WVSu} T uHu T< uz8uBTT A<wNj hTRb=t=u=r8"u3h&h gu BT1e[^_UVS1TETT8%FU8P:@T=P8h&h _!NJTvV@9~q=}S5P}@P u,t jt jPTTF< uT:I<\uSPTTF u7=Xu. TQ` &…t~ D| uޅTU8V@9=}S5Pkuxi0kPh&5\Q  h&h ď =u)t jgt jE1Q@P u)t j&t j5HPPe[^ÐUWVS8EHP8Ep)‰9E8P8P诟URU RPEPƃ y318PPiWDSÃu> +t jjt58GZ8PPj ǃu> t jj94 u,t jet jCE8EHp)‰9Et8}u E uh'h ;E tU R8PP|1e[^_ÐUWVS] DžDžDž1SLƃ=\tj jsVŠ[j SjVEP DtE , j RjVEPE }t9Uw L9=}S5D;50RgPh&5\Q h&h 萋 =at j/>j /LD u,t jt j=\tjj (VDWVP辊EpW RV M(L9=}S5DʆĴ0ePh&5\Q( h&h  =t jjvLD u,t jvt jT=\tjj WV蕝DWVPO(ƀ>)TL9=}S5Dou|m0dPh&5\Q h&h Ȉ =t jgtzjEnvLD u,t j&t j~1( ,u#Uth'h `=\tjj WVDWVPʇD+'ftD1[^_ÍvUWVS}PE=HTvU<&M 1Y];)L9~o=}S5D蜃8LD u,t jt jMA;uD]FG;u|{<\EU<0<9;EM 4DE)L9~o=}S5D趂RLD u,t jt jMA;uvD]FG;u|Lw9~r}S5D LD u,t j;t jDMMAM+P;HWL9=}S5D`u}^0{`Ph&5\Q h&h 蹄 =u)t j\t j:JvLD u)t jt jDe[^_ÐU @D9H|!dD@PQ[tb @H@Uu觔H@@Lu 舔H@@LHdv0_Ph'5\QY h'h PK5@@D1ÐU,WVS8EdE=Lt =Puh'h =Ht @j蛓=HO  @t1t ~x5APAAA@BXvQBQPCQAAABAPAQA@BQAQABO1Ob=H}WO9U~l5@vECECEGU)RDCDCEEDEDUBO9=XtɛL8ELPdEP u)t jt j1e[^_ÉU WVSJH @@<u.D8t9t vV V|| 9u H=HuH8LdPe[^_ÉUuu ueÍvUSu uÃu h'u؋]ÉUSuzÃu h'D؋]ÐUSu uG|Ãu h'؋]ÉUSUE у#[ÍvUS]U ك [ÐUS]U ك![ÐUS]M 1ҋBv[ÐUU1@vÐUU1@vÐUS]M 1ҋ9t1 Bv[ÉU WVS}1Ԗ;r}+1ۍvPWuf FԖ;r|ډ‹B9B|2vBB9B}ԖPR0}¡ԖԖ@SWe[^_ÍvUEU Mܖؖ ÍvUUv Rzi N4%%ÉUUv RBi N4%%ÉUUv R i N4%%ÉUE=wB%1UE=wB$%v1UUv Rh N4%@%ÉUUv RRh N4% %ÉUUv Rh N4%%ÉUUv Rg N4%%ÉUUv Rg N4%%ÉUUv Rrg N4%%ÉUU1 t uÍvUWUװэA9rP5R%1}ÐULWVS11ۍv8JGr $( =uh>(V|  ؖ(== _ P ؖ t~*8)~8\u x)f=ؖ}~*8|~8\u x|  8  w ٖ@  h ږ[ n v< ږ/ B v ږ  v ږ  v ږ  v ږ  vؖY 9J u =8 K  ؖu =    ؖ 9 u =    ؖ 49 u =y Eű }|E̍TBЉUA9tUBЃ v9tF9,uAA9 BЃ w0| DBvBЉA9BЃ vu99}}| ;u=uR( P0x8 GЃ wYvDGУ=uR(M Pw8 GЃ vvhj(w,=uR(Pw8 GЃ vDGУ=uR(P$w8 GЃ v|&;}hj(v ٖuK\thj(v=uR( Pv8 }t hj(pv  ؖ49ؖrja  jvؖ 49+.vؖ 49u Hv]SS ؖ@uSPb=ؖ}SjKS:@ږ3]SO1vV^ N4%u_uURVF~WuEP]S=u(P.t8 ^uB=u(dPs8 E vE[ؖE=TT]43X=t.t.up.1V׃tEPVVF~ڋTװ I эA)‰Уu(FPrU EԋEԃ< \u?ؖt6=u(Pwr8 =u(PArU -=u(pPq0P]u v\u?ؖt6=u( Pq0 =u(PeqU EfEfE܉UffE1]ލu܍vEfEfEރSVEPSURW=vWZ N4%t*EPvWHbN4RvWZ N4%t4URvWN4P5G}ԃ]5}t/EP{ٖtURPEP=vWYvN4%]SSWp vWtYvN4%t*URvWvG:N4*EPvW謸vN4PUR%C-le[^_ÐUS]ԖB9B|.BB9B}ԖPRp ¡ԖP ԖHP @w$\*v Ԗ@ Ԗ ;B~B]ÉU=v8=1=t*=t#=t=t=t=t=u R;=uAjM=th*UmhÐUVS]Ԗ@ D=|= ~== }2CP@!CPƃF)SDe[^ÐU WVS}u 19}!vԖ;@ 4C9|e[^_ÉU WVS ԖpơԖx)=}h =uh;}UVW6h i C;|.vVWhA h 1C;|Re[^_ÐUvh =t = t}ÉUS]= u=Gt h vh [= tċ]ÍvUSEU ]Ԗ=ܖuh*jjC j'=th*2jC Ph  { t h~C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐU WVSUM 1EX9})];s G9};r;}} ;u L:Ӊ΋UBHJ9}"ULtGӉ΋M;y|[^_ÍvUWVS}EEGEU;BM ;A]3E M΋M9v]ދTwTC]Q9suT_ىT/]ދTwTC]O] uD DFuGEU;B}EM] ;K\uE;p}+wU]T؉TC]Gu;^|֋EU ;B}-vw] ]T؉TC]Gu ;^|[^_ÐUWVSu1ۋUB9}H;2tvC9}8;4u9}/PMQ9} vEDT ىTCU;Z|[^_ÉUN4l%u l_uvl]Al~t&DžlElyDžl9l D$TvDžDžhllA<0l,h;(Džd9DTPˉ;hȋ‹dȋLQRcd03h؋] S0d;\|h0h$; i] {4tGDžh-TQ@hȋLQRh] C$h;P|DžxD,PPRtVDžhTA9h};hT%09t Džxh9h|DžpDžhD,#`u)D1Ƀhhwh#`tჽhwUDžhTC9h}:hTЃ 9t Džph9h|jjTRM Qǃxt!jjTSE PttptjjTRM QeƃDžhDždh4h@84,Ddtmh9utEHvS: N4%u_u M4EG@tPIG@GHtPIGHC;_8|G<GPNe[^_ÍvUujMÍvU WVSu эy];t!vWVS襲u C;u1e[^_UEt P@UVSut%1ۃ>t4@C<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvF<u1vt+PU RuG␃4?N9uPSl@Åt"E DU R?1e[^_ÉUWVS]t} tjx>Eu 1vE;t{EPE P2S3xt:PuAt:t;MvMVWIuƒ}tEPSEP_EtC;uEe[^_U WVS]t} u181FE t%װэAPRSÃuЉ؍e[^_ÉU WVS}t} tjU=ƃu1VsEE8tpv1U :tTE 4UE4eÃtSVƃS S=tGU <uEEU<ue[^_ÐUSUZJB 2]ÐULWVSEEUB@PR<EƋMQ|EĖ=Ė}HMx}ȋH 1Z}U<}|}ȉ|L Ku1ۋE;X}j;j;G j;Gj;G ?TOIW>6CU;Z~EM};OUB M "RkL }< +vv;uvE 9lu}w v ]tF 1ۋFtMy:uC t:;tVװIMMIMĉэyEE9~}1;]}/MĊD9M8D uLIC;]})؋URD8t19}})ߋF9A9|FM16QÃn66: ;;uEF "E9(1ۋ}E̋G EЋŨ:t>U؍vM؋4эQ}эA9vuCŨ<uȃMQ}W8\EE 9uԃE06wV:tqMԋA8tfR]ÃN}wSÃ2߰эAPS6ST9 >F 8tUrvGFMԋA 8uF}wvFF 8\W :PRPF dv|utq~VFVN VFN VF@BAjv 6 tEEU;B}tKj .7ËU}Q7C URPEMATCYT1ۋ};_Mu66 vv v CE;X~UR7e[^_ÉUUM :t9u B:u1ÉUWVS=,0EU99~|U+UE)9~5M)M~U ƉNuMM/v:E~ME ֋Nu}U9U~9+0,0[^_ÐUS]0, h@+P8(-u$C1v+u$Ct $ $؋]ÍvUMytF5D=tPPM Dx-uE01h+5\Q'M1M DP1h+5\Q װэD UB vMy@;E}U Dj=tM t1h,5\Q װэD UB ?M9::v װэD }tMU EPUB }t-M x-t PEPu}=tNU x-u5 2h@,5\Q##5 PM 1h`,5\Q ,?  VEP 9ut:uR=t7=(tVU 2h,5\QvVM 1h,5\Q^ã?vP8W;EEEE9t DQ;Eu:=tVE 0h,5\Q5?U:::M D5D5 Ft<=u]E"}u]E؉E vEE؋ tI )PRQРu؉+ ;эA9u]U؉UE}tZ}uT=tM 41h-5\Q װэD ?}:>taUzt F5D=tM1E 0h@-5\Qy װэD ?|Uzu{;E}M D^=tU t2h,5\Q װэD ?U::: װэD }tM܋U EPt@ 1vUB  W:x:u 8uaD`v 8uH;Eu8=tPM 1h,5\Q ã?E8:u:U D Íe[^_ÉUjjjuu uwÐUjuuuu uUÍvUjuuuu u1ÍvUS]E t'P PS5ԗh3/5\Q/S5ԗh?/5\Qܗ]ÉUu ujz5US]S*tujhG/v]ÍvUSE] tSP, vSW*tujhG/e]ÍvUU:t< vB:u5D<‹E 1ÐU WVSU] H9w@tPRh+ P)tƋ=1хt)v1e[^_ÉUWVSu}Et9 %h/U1uхt )MEEUwDEu6-] s ى1utE) U9r2%h/9u#UB;UrhRujhG/=$t+hX/VY ujhG/5GPV4tW0hZ/wv=uG %f=@u1=$uG %f=} u>jjjVN3 =}/{W0h`/1nv   1=̗t1RPSQHщ % e[^_ÐUu4=PuH4}tMQsEPdEh[^_ÉUS]t65ԗh05\QY5ԗh@05\Q@5ԗh0U5ԗh0B h`12h@2% h3h@5 h9h@< SG"vUS]Ht!SP:tjh<yH]ÐU WVS=tF1ۉ4EPA:uF <u1e[^_ÉU WVS]u 1CvRk N4%@uҀ;ua}tE4G/vR$vN4%@uCF<\u t FC;uFie[^_U WVS}}QIEjPEPNjE0 E 8PËE 8ESEPEPue[^_ÉU,WVSE ԗt+j/Ptj/5ԗ@ԗԗ8zu$@ԗEEEP З@DEEh<j2E PEPh<P UU$>MTBЉUUovD_hDP-Fjh<ovD'h@Pjh<7vDt'URPjh<Eh<?h<3h<'Eȗ5Dj<Y,H?vDƿ<uƿ<uƿ<ujh==DуU\ sVMQ#E5DEP!E u lDƿ=thX/P. v5TQuA05DUE@9w v9vSURE}EC9EuSMQfEF uVE@)RjEEP農;5TQt V;;}EU| } @EpPaXQ,Lt-,Lt 8t,vT0TL$PDƿ-u (\ƿ-u (=ƿ =u (jh.=Ejjhh-u uvƒ @=D}ED=@}E@=Hu ԗH=ȗt^hH=5HhM=h_= h=h= h_=j=ėt j}t}u 50GvM?v;U}%E UװIMj5Huhw>vuURMQСU)‰Ѓ~ =Pt}t 4E9}bEvU h`޿=1t 1҅tR!EH ;E|vh`jE5XQ8u}=0hq/=ܗuEPdU WVShHÃhPh|jjSC, C S)‰Ѓ }j SC C {9uK(CS !‰S K)ʋs)9~s C C{0thC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S 1e[^_ÐUWVSE@0EUUM Mm]DtMMU M]]ExEEEtWU:W tGUv|ЊM:O sDE?Et]:_ uą UB J)ȃ}jR+]C C s9uK(UB‹MQ !‰Q ]K)ʋ[)9~EX UB BtGMA Y)É؃ }j Q UB B r9uJ(MAQ !‰Q ]K)ʋ[)9~EX UB Bwu @\vG@GMHG@ G@GYCXG@EG G MM|)u UЋ8 vUЋx}UuЋD*ЉӀx uNMM]MvE<u 2H v]@ M>ʍuЋD)Љˀx tƃ}#|+uD+ЊP ɈH u"|+D+ЊP H t+ЊF tCV)‰9C~C[uv \G0p t"F@9F~FF9F~Fv uIySG0pDt)1ɋvA~#v1ҹIyDt&1ɋ1A~"v1ɋA~1[^_U,WVSEU x4u v;}uMQ<PRp<}<]]KM@E UU9EGU)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvEA;Eu39UB8AuvC9{)ڋE)؊8t9hM8A0E)9c]]mA0uAA;Eu59$U8AuC9)ڋE)؊8t9~)UE)9~1e[^_ÉU,WVSUMA495M<MM;uw9t>vMƊU<t;urFNU<uc^M u)PR5 t jP9sF9r5 t jP]e[^ÐU,WVSPEuE 9'UUEEvEPE)PV5 ƃ}=Lt-;uv U8V7;EU8=T;]v3SvR" N4%uh{_tb;EshvRvN4%u<_u4EPOWV5 Ë}tfF;u167U)RURPqBuUEN;uv~ ue[^_ÉUMU vABuAÍvUVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEuSAUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PURÃuEP21av]EuVP3UUEUt*1}tEEPUR;YƃE}}EPUR_]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÉU WVS=\\hh`u_j.h`^ƃtGVװPRh`e{'QD7 RD1PVE{``H`=`uE D0E`|:u{XhA3PX~`=`)E)9wJӀ<3W<3.u8ChA3P~؀<0u `)ʋE)9%FE)Pj.Vƃt15`h`FP\uǡ`|0e[^_ÐUWVShutSƅsjSމH j TS蟀DžXDžTPPSjVw u PxuAWj"jjtװHPRPpp  tPhA5\QFAjj hA)\ǃtPW`ukju]Sju EP jVEPqEP j,SW.,tEURPW}W8[^_É$FreeBSD$$u<`%`UE]EÍvUEU щA uNu~AvH҅5v ~&HɅv~ U=pu?EEUB jjEPhpjRu ppÍvUUBB9u1BÍvUUB B9u1BÍvUU9Rt B@B9u1BÍvUU9Rt B@ B9u1BÍvUE9@u1@ÍvU WVS]u 9[thCx҉ЍDPiǃCpW VWGCp=CxC VSe[^_ÉUVSu] 9uS CBSC B sSNe[^UVS]u jCV‹CPSCBCX SCB CCCe[^UVS]u SCC s S4C@9Ce[^ÍvUS] j $…1BBZR RBRE]ÍvUS]9[ ts S9[ uCC]ÐUSj$ÃjSZCDC C (ChCChCC ؋]ÍvUExDu 0LÉUEU xDu} vP1ÍvUVSu] {t/{t){ t#{t{t{t{ t {t;uU~DtCjVuF FDF (FhFFhFF G~Du 6qCFCFC F CFCFCFCFC F 1e[^UWVSEhAu ذǃt|EPWFOƃt]uhAVxVuEE&E00VE0‹BЋE0EEPWNƃuăW Ee[^_U WVSu1hAu *Ãu SShA"6F Ѓ t'phAS;y6FGuڃS% e[^_ÍvUVS]u 3C 90t3CЃu1e[^ÉUVS]u 3C 90t3CЃu1e[^ÉU WVSu} Ѝx6F&WsE PTu6FЉÃu1e[^_ÍvU WVSu} Ѝx6F&WsE PxTu6FЉÃu1e[^_ÍvU4SME 1ۍUz$A21A D21A81A.1A"1A 1A 1AЉv1A2Qv2Q2Q2Q2QA2Q2Q]]vBE܃BEBEBEBEBEBEBEEEPQ*u Q؋]USEU M] ,$QS0]ÉUSM] Q,;A0sA(9s9r J;Q(sY,[ÍvUVSu] V(;F,v^,)Ӆ~0`;dt v(SjVTV(;V,w B;V,v)^,e[^ÍvUVSu] V();F$s+^$~7`;dtF()PSjVV();V,w B;V,v)^,e[^ÍvUVS]1ӁvRk N4%u6=wB%1uSh@BPte[^ÉUS]ӁvR N4%@t1?_t)Ӂv R N4%t v]ÉUUvRqvN4%@%ÉU WVS} ]KuNt<K9rPU҃tK9rPU҃usC9s؍e[^_ÉU WVS]} uNt=C9sPU҃tC9sPU҃us9v؍e[^_ÍvU WVS] }EHEtvPU҉ƃC9sPU҃9tE@t79s3vRvN4%@tC9r̓ms9wve[^_ÉU WVS] }EHEKU@t:9v6vvRvN4%@tK9w̓PU҉ƃK9rPU҃9tCvR/ N4%@u҃mT9re[^_ÉU WVS]@t \`@ǃ@DC(;Dv++DVSDC(SoI 1C(;DsD)ƃV vjS t~"tuǃ ǃ vC(,(e[^_ÐU WVSu ]C}O0vRvN4%@tC9rvR N4%9vRn N4%teCɍvvR<vN4%@u1vR N4%uC9r+K؍e[^_ÐU WVS]hC$1C$C(C,C0h0ljǃ ǃ$ǃ(C$,ǃ@DH h4ljC$<48\`C4C8C@C<CD"ǃTǃLj(P1e[^_UEP$P(P,ǀ ǀ$ǀ(,ǀ@DH<\`@4@8@@@<@D"ǀLǀÍvUS]s$WC$C00;ǃ0 4 ǃ4PǃP S]ÐU WVSu] ߰ЍPt F,;F0r#RV;tV(CF(;u1e[^_ÉUVS]u ~'C$9C(rVS&C()C(;C$sC$C(e[^U WVS]} 1E}EPST7tjS%vE< t <t< t=<t<u4C$C$C,C(iC(K(C(C,>N2~S_cE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S<C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8SgD v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$C$S,)‰C<Sh<uESTSd2}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRS=uF$V,)‰Ѐ<tSV=tE}tVK%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅVI=nvV$F,)PRS<uF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uV<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWShÃ1E @C ECu\QCSHJ ShS SSj Sb9S= S&SECǃv1e[_ÍvUS]t|SySdJ SgS SS S9S S-&SE 3S]ÐUS]SmS]ÍvU\WVSu} M E$lB1V%11VyT!1VE9tNf1AEt]vB AuG$BEJBEPRVEOBEPRV\EVBEPRV]jE\BEPRVK_REcBEPRV?m:svQA1PRVR A1PVZ e[^_ÍvUE$ÐU WVS}E uCuQhBƒt;hBRhBhS؃ hBP腑ƃuEbV퐋| uRW9 ÃtÃPV/ƒuVq1[^_U0VSu]S%jS EPSjEPEPVT tuuVyUjEPjFe[^ÍvUUE ÍvUEu1US]C(;C,u2;C$ujhBSiM4Z0SQsu h`YvuE8uhYsN1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uhYpNtRP1UVS]u u>t1"jVS(Vh ZsMe[^U WVS] }u:u@{ t&WEPt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tv]gvEF}t  }t *t!UFGE03F3v~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tsŵϸvS诵]ÉUS]j蔴@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"Dh@ZvIhvZvI~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuSZuZRP1Pvt :t8;Bu2S5|vHkvhZS5|vlH[^ÉU WVS}] uu;^C;@vvV询 N4%t";^Cu ;?v$ @^u;\C;^\u;\C;\ tQvV6 N4%t.vV vN4%@u%;\C0;C$0;C$0;؍e[^_U WVSU}] ?t] C:u^C@Cvր>vRlvN4%t^C>u ?$ @>^t>\u\Cv> tYvR N4%t2vR֠ N4%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]h蛯Xh舯\ǃdǃhǃl hDTƉthl.Ɖx [ǃ|[S1e[^_ÐUS]XܯǃX\įǃ\ǃdǃhǃl t苯ǃtxsǃx]UVSE\vS N4%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSN S Be[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM VWAe[^_ÍvUWVUE ƿZu R"%ƿZt Ro1e^_ÉUVSu];t{uXhZPSct9t?E v9At 9u#1PhZvZA SVV[^U WVS}u M]Ȉf؈f<1"u;9hZPPPhZw@t:ti19BuW9tc2hZPPKPhZPP,PhZwS@? :u+v2hZPPPhZw@[^_ÍvUVSuhZv?11ۃ\:tCPQRVكC~؍CPQ\VchZv?11ۃ X:tCPQRV2كC~؍CPQXVh [vG? hZV>h&[v&? hZV=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$[vXvDžDžzDžnWWKt;s3h:[w= ;uBPU2hB[w=FM#E<uW|u3U4FPyÃuM1h`[EFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0h[vt'RQWPSWU:%vPRWPSWE4WMuU42h[w;t'QPW8PSW9kv{t2RQWPSW`1SQW vv1[^_ÍvU WVSu}|} t }tu Pxfx[Ptet|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)E+E)‰UԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)E+E)‰UԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EtcURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPuSVEEP])SWURQSWEPc}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPK }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovS证 N4%tF;u~>6vSw N4%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV3vSo N4%t&t @?j^V/vvS N4%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]h ǃǃƃǃ1]ÍvUS]ǃ]ÐUWVS}] SWtAjSuVeu&jjjWV ؃V螦1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$xlHe[_ÉU,WVS]C(EUEEU} C,D;C0 u3:.*EEC, C,u S,FC,>uS,C,p9sS,FC,9rC,SEPS tjSB%XE`'wr$]vE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(hxjs,Pƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S<TvPh]$9vEhSEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=?uIt ǃ ǃS-<u SuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jS袻 jS=E}t(uC,vC$C(W@PS0}uASE9tS<US(?:WSE<u=?u }:uE}t }uZ}uTEU쉓E9t Su<u /vUS(}u Sk}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jWG( G(G(G(} u/v?WPW"p uG$G$G,G(8.8*hPSe.@*hSPe.* 2.F*FhP0eE GDG$G,G(} ujW觸<t&jW9<uWy8t&WWG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQ5%jQy%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(S<e[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(S踧e[^U0VSu]SVS[ EPSjAt tDR5%j5ִ <u5I$v5.5(1Ƀ=t#;5tvA<t;4u4V&jEPjz Vj܏e[^ÐU0VSu]SՍjSJ jS<jS1 jS#jS jS jS jSEPSjڋ j$I1҃=tB€:t 1BA:u苅B9rMyT󥋅UBX=~har.MQUBXBTP UBX@BX[^_ÍvUVS]sHSC`@HCH>@FS e[^ÍvU WVSuHF@Py1ۃ;^}@PyC;^|FExF@Py1ۃ;^}@PyC;^|FEx e[^_U WVS}wGt+>tv3Nz;uV:zw G t'>t3z;uVze[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8th > VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.h > PPPG\7PM@vG\xht4@h8t,1ۉ9}"ލvh > jG\phcMC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8th > E PPPr~3W\t'8th > VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$h > RRR6PKbGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'h > SSSF\px4PJvV\z tB 8th > jr JF\xt*@8t"rh > jF\pkJsV\z$tB$8th > jr$@Je[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5h > SSSG\3PISVWAW\z8tB88twz(tqB(8tih > jr8{I_PF KuW\z<tB<8th > jr<>Ih > jG\p(&IbW\z4tB48th > jr4IPF5 GW\z<tB<8th > jr jr H19}j C9|we[^_ÍvUS]S\zt!B8th > C`pr#HeS\z0tGB08t?zt9B8t1h > C`pr0Gh > C`pC\pGj j ]ÍvUMQ\zttBt8th > jrtG4Q\ztB8th > jraG vjU<WVSu S}jS;} PSj|uhajtƃt>uaUzd1Vrd#1ǃuhaEpuVhaUr<h bMq&UB`@PB`@@ MQ`BB=jSEPU;uha3‹MA`hFa3‹MA`P hVa3‹MA`P h-a3‹MA`P hka3‹MA`Ph~a3‹MA`P =t*V3B4PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPjy MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s |tEfxt@f}tEEPhht@s Y|tEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h?b@@@ @$_@@@@ Db@$@(@,@0Ib@4@8 @<@@Ob@D$@H @L@PTb@T%@X @\UWVSu^hsCEPhdVds CEPhhVO st<>u%EUt DPS]SͰ>Ov<>"uISWEP,EU| u D>EUt DPS]SxE} e[^_U5`u5ÍvU5`|TÉU WVS}hXbwhqbw  G`pphbwbGP@tbPhbwbGPtbPhbw_\=tR;t$8thZP3;bP6vhbwT >uwj u41[^_U WVSExxp@E;t18&U3cu/bUBPtcP5Mqu8cuUB`bx tcR봋u=cu EhBcp'uMпGctLcuUB`p5r'MRcuUB`plj;t4M13荇u-uV\;uPE0(t :uPM1h`c31;tLv;%u>CMw$dvG$tPhcEpC;utn t vEU:t(8t!PhcMqh > jV8EE8t8u!Rh dUr:1ۃM1uƒEu>t(8t! PhcEph > jRSR"P7vtWh`dMqEu>t8uh dEpuU2tÃEM9t8uuLh d7E0tƒEM9t.8t'uPhcuv(vh > RRSP!P61[^_U WVS]EPs ghl 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP 1e[^_ÉUWVEǀƀxl-󥍸 `fPe^_ÉUÍvUS]SEgu S)g]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJ HJHJHJHJH"JH J@!BUUE JHJHJHJHJHJHJH JH JH JH JH JHJHJHJHJHJ"HJ @B!U,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEE=EEUMEBUEE:Eu } MQEPSUM M EPQSѤUup0M }t=EPWS衤UM :EPWS膤Up@0: E E86e[^_ÉUWVS]Hw1Ps c%=%P􍳘V ;t!VZdV;d !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs `tǃ1e[^_ÍvUS]u1.lPjs `tǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs _tǃ1e[^_ÍvUS]t1.Pjs |_tǃ1]ÉUC $,hC 4C (SCC C c${ wcC $@hK$C K$뼉{ C $ThC$tc$0SwC UCU1C Vvc${ wVC $hhP3肶t*S 5C\CC  C SC SB9CrCC)ƃVPyElj+Kt!1;S} C  B;S|KKs{SB9CB CPs C ve[^_UU:t2v:%uB tpuJ:$uz%1Fr8$hN*|hh Q)Ѝ(h Mb)‰)Ѝ) F;u=!t EMvMAMtUEEUfEE\F9~FIu`u`> gfff)Љ)‰})t<3WEPF}=ЋUTUE)~!]EvMAMF>tFEE;&P5P}t65!EP4O=!ЋUTU𡀛Me[^_ÐU WVS]} uStVWS WVSe[^_ÐU WVSEPju }+!Hy8t0Pq8XjB%u!PB84!@t !!@xLt@L!!@4t 4!!BxtAxt;j*Bp艱t@PQ1҅t !@ fPD!BtFt=j*B0t@PQ1҅t !@ fPF!@(t (u8!Pt't(!@ǀ!@,t ,ul!@t[tRt u@!@t u&!P,!@ǀ!P fzBu$fzt@ttBfBB!P@t"tZjuZ)!Bx8tCx8t=j*Bp8蛯t@POv1҅t !@ fPH!BtFt=j*B@t@PO1҅t !@ fPJ}t= thh EPyEe[^_ÉU WVS}=!t\5!1F9}J+~F")‰Љ)‹F v\jjPWu F CV9|1e[^_ÐU WVS}=!tl!1C9}Z&~C$)‰Љ)C"‹CkjPWuuC f%tukF ]]EEE|DžxDžt1E%A>vXwD$zAuGA}tE Ex1TGEK}u:@=wB%1tTPЁ'~EGA?ta}t%1DžtDžx|%AA}ttxt;x}xU]l $P|%l@;hv Pdll, 1҃=`~ ``Ĝt=ӋUlD;hv PmSW!=`~& ``ĜutװЍXl;hv PSh xv!=`~& ``Ĝut pl]װЍP9~ڡlD;hv PplRpQldP?9l=dװЍDlFσtE܃<t$=`T`ƀĜzESF<w;1҃=`~ ``Ĝt@<1҃=`~ ``ĜtF<w<<<F=``ƀĜ`FF1 \BF< v=` `ƀĜ`1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt)щmv1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝtȅtә11҃=`~ ``Ĝt1Ƀ=`~ ``Ĝtȅt љF1?11҃=`~ ``Ĝtta.11҃=`~ ``Ĝtu,1҃=`~ ``Ĝtt=``ƀĜ`d1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt!+1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt 1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt1{1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt9v1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt9v1҃=`~ ``Ĝt1Ƀ=`~ ``Ĝt9`1҃=`~ ``Ĝt,1҃=`~ ``Ĝt҃=``ƀĜ`}uE}E1҃=`~ ``ĜtulF1 v>tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F> =dujjdu1vdldH[^_ÐUS]!@xtwSc!Ptغh )!~v!P!ЃK=!| u 1]ÉU=`#t `#@XQPÍvUM=`#tV`#t4MjEP=`#t `#@XQ@P5Ev=`#t `#@XQJy B;B| t  vRQ"1ÉUh| juÉU WVS]}tu =!uEwE!@;Xt;uEE!BxuJB fx t@=`#t`#u)!P¡!@ @ 9|E1=wB%1=wB%1ttPCѐ4;.uOC=wB%1t t0C=wB%1uۀ;*uu C=!;;$tP]C;Sښuj$׃j<׃ g1ɉ=wB%1tLPCѐ ;.uOC=wB%1t LC=wB%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)P^!| 1e[^_ÉUMMb)‰U)Ѝ))ȉ)эEPjP1ÐUSE!!t6f!!@t !؋]ÉUS]t*SeCSx';!u !1]ÉUS];u >|.19}u }Aw9}u닂}[ÐUSE|/19}u }Aw9}u닚}[US!XP-ÃSf!=!t !؋]UE!ÉUVS]u =!u!!@ @!@ h`~~hf~~;~>r!@(PtY|TEPhht@!@(Pa2} MT8u CT8tʃ;E>E;~>(!@ fx~f8~@!@ ;~> P!P fB!P f!@ fx| @! !e[^ÍvUEPEPj=`#t`#dtuudÐUVSu] j/Vĕt1tSPV$tSVOuE1f{tvC<}BC9|1f{ tC]vRZ N4%uh^t Sփu Sz1PEPSr="t,""t‹ƒu"D#[^_ÉU\WVSEDž1"1"t~9vl31tSFu(01Ph5\Q荬G ~!31Ph 5\Qg u~( \QJx Rj Q0~1DžL# "Dž;B(010‹IL,D4ƅRF[" tPR4;t-hQ30tƅu}1 EPPP!udhÃuh[ߍu C(Rƅu>H#Rh cZI;H(StQ1v"Nz(Dž;J(}+0Ix(A;H(|؃RQVfx(t4Ã0B(H@4Q1TH(uӃRQ Txtpz tr }ytqc  "1ҋfxt#A<uBA9|1ҋfxt(vA f ?uv=tb5"7uAhw"Ãt.}u ww7hn> ?u5"Ãuq="tAEP5"UR:Ãt&=@#v5"hɏ=u#}5"h=}M9Ku=="u&="%P!PjhA}uF="u/="%Ph!Pjh!à t}u{u E_v}Ct"t "t 5"Ph <h} }t~}}Ct, t*t3S]C SMA fPvS]CSMAK]S "fJ5"="u!CEPV5"9%ƃV3S]C \w7h;Fw7h`;2}uhGq;,="u:PEt AEP=U29P:0} ="umEj+M1ftE71ۋE;X(},j+[E,4fuECU;Z(|փEPMQ}v]SH EP21e[^_ÍvUMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UUtE EUEEPu6ÐUWUt#װuPu u}ÉU<WVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhhSKSb0‹MAP hC0‹]CPUBx8B fxH~7@HPhhSS/‹MAP8 Lv]Cx%uh/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhhSS2/‹MAP, h/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhhSwS.‹MA !vhk.‹]CUBxBx)uVB fxF~<@FPhhSS.‹MA +hvUBx xt~tutlh VS2MApS2 UBS2V_-‹MA}]Cxtyxtsx,tmx,tgh VS1UBpSE2 t3MAp,S,2tV,‹]CUBx+tx'u MA@]CubC fxJ~:@JPhhSOSf,‹MA !vhC,‹]CEP fzu@x*ufBUBxuh+‹MAP]Cx*C fxt!fxt@Ph3UBtPht'MA2Pha3 9]CuhH+‹MA]C f@UB8_8Rji8^ƅt ymMA8v)Dž\8t)װH9u׃SVR^uŋzuVSh@Z2Ay3h1Ãhpƃ tuh2vSMA<u3h1FMQ<tP4C4V]C4"1P0ph|1 fvS]C:t':$uzuvAB:uP+)V]C Fj,V\*t4EP4u% t 4UBǀ MAxAuh(‹]CUB<uhc(‹MA<]Cuh6(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhthVS+UBHS , MALjjSZUBHjkSC MA@jlS)UBDjmS MAhjnSUB`jqS MAPjtSUBTjuS MAXjvSUB\jwS MAdjxSetbV%‹]CHh -tŐEP4u"j8 9zuB9u C<u냍ve[^_UVS]1Ɋt$<|t Awt<|u縠[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÉUWS&="uzhÃtd߰Ѓ =wJ߰Ѓ P^"uh*Sh5"h"1e[_ÍvUW}tw?t 7tw tw twtwt w1 }UE""ÉUlWVSE=ijt+ijh@(ijO t  ǐc ƃ t t t\uG t t tƃ=:u :u ƃ.u)="u Evƃ.t t tvV vN4%ub.u ="uTPhqSu:VF$Phh ^' P{v=i="""H#""<,u",\u t t tƉCƃ t5uhU'v:u:,t":="uH":UhhPh;&v="uvK; t; t;,tCj|hQÃuЍ3h%j|hIƃ t>uhc%uЍ9s]vRvN4%@;/PhQC9r"/vVW N4%u="u _u;uCƃuC:t='#,t=3@t2y9t h@@%"1nvO9tV Phh$ "&v1ƉvV> N4%t D/GNv]jEPSǃ9]uhh#E8u 9tha#"="rvhSz9th#"") VPhЕ" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uhV#w)vW N4%uWPh#" ?u'F=@#h!}s\[É߃u!h"P GЃEEÉ߃uha"CЃv3wB%1tSh@K;/K=wB%v1uڀ;.tՀ;*tЀ;\u#~^t~,uFh>$uO~.t>*t >/t>>uFǍvN>%u"~%uh]EPl>%u}hIEPEPh`VIu!j;V8ƃuuEPEPEPh|V tTEPEPhVuj;V38ƃuuEP7EPEPhVu-j;V7ƃuu}W>E؃ vVtƃhEPQEPhVNtEPhV4uPj+Vu7t>phd}WE؃}tEEuEPvjhNV7uhjhV`7u!E}hEPljhV(7uE}wh4FN7$%hEP%h}WE؃=wB%1tFhEP뻃Ph6>d1hvhEPjhuZF>1u E>2u/}us}umhEPJEEMv>2~E1bvh2}WE؃%vhEPE؃E>tF>t ;u1}u|e[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,C{ ujNtC {uhx[C1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|]ÉU WVShjWÃtߋuEPS؍e[^_ÍvUWSUװ׍;=wRP=e[_ÉU WVSu-|1f~ tF~N <u #F!FF=vFUr2M!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Eu9uU‹M)ȃ"];CvӋu~V FF=vFUr2M( 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2HM\9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr2\Mp9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] C]؉1{u]tu؀NE9Eu EEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9E萃EPURMQ]SEPH Ez}[pE8:du9aEEE9EUvM9M<EEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пx7E~7E7E7E7E7E7E7E7E7E7߹E7E~7߹77x77tv7tc7tP7t=7t*7t7E9EEU9U1ې}t,vS詋 N4%}t.vSw N4%}t.vSC N4%}t.vS N4%}t&wB%1T}t.vS诊 N4% }t.vS{ N4%}t.vSG N4%}t.vS N4% }t*vS߉ N4%@uT}t*vS诉 N4%u$}t8wB$%1tكM CEr]tEHM}uEu؀N NECvEEЊMM v]؀{tC|uuNt F|tUB‰UAM v] lvuf}E%=E9Eu WEEEEكUa$9U LMAEE;Eu-EPu̘E]ۉ]EUMċu+ EM}t E+@DDEUu؋]+3t EUMLUME+D‹])É؃u;FӋEx"P҉Pv @vMq1ܗu9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuFEFFuEEEU؉UEM }urA}]‹u)ƉvӋExP҉Pv @vMq1贖u9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu؃EЍDPEPj Z}uUq-MEU] 4Ήuă|t LIM vEEU] t Ήuȋ|E9LȊU(ʈ‹])É؃u;FvӋExrP҉Pv @vMq1,u@9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuFFE(ЈEM]‹u)ƉvӋExzP҉Pv @vMq14uH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuV+EăPEPj&Eu؃}t+EPURj M؉M]‰)ƉӋExfP҉Pv @vMq1 u49tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXEEu؉uCE %= E;Eu U9U ]MIu9uuE pvEEE}tEUЊEE=wB%v1t.}}EuEDPЉEE9Et대},uvu9utbEEE}tEUЊEE=wB%v1t}1ۍE\P뙍v} ]}|UM9]Huu7}\E9E!EEE}tEUЊEv}}t] }u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr2TMh 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj I ]؃vvE ~EU‹M)Eu;F׋Ex P҉Pv @vMq1Lu` 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQjZ E uVEPjURj; u؃ 0KSE)PVj VS+EPMQj u؃0vM]96 ȊEE}tEuЊ0E䐋EkU9U_Ex\?Mj#>M؉Mȋ]‰)ƉvӋEx P҉Pv @vMq1|u 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu j#VE؉EȋU‹M)@];CӋu~ FF=vFUr2萌M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Sj#nu‹M)@;FvӋu~FF=vFUr2谋M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]sj#u‹M)@;FvӋu~FF=vFUr2ЊM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]j#u‹M)@;FvӋu~2FF=vFUr2M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]j#u‹M)@;FvӋu~RFF=vFUr2M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]j#u‹M)@;FvӋu~rFF=vFUr20MD9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] j#u‹M)@;FvӋu~FF=vFUr2PMd9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] u@,EЈEE;EPuuu-U؉UȋM‹])ÉӋu~FF=vFUr2@MT9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CEC]ZU}t EMЊE}]D;Eur;tmE8*te8^t`ut8\ux+tJx?tD E8+t:8?t5EtE8{tE8\x{U؉UȋM‹])ÉӋu~FF=vFUr2踄M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CC]K]̋u‹M)@;FӋu~"FF=vFUr2M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈Fu؋EU9U7}tE+EPMQj m}uTu}]u+3s1? 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP~1ҋEt 1ۉSURMQSo}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:},M9Mu(}GU $gGEMUEUMAM$:}OUBM}74G}v}FM}F$)ljsENyLU2vMF~}74G}v}FM}F$)ljrENy1@<uUF~1@<tMF~1}>F~E@ @u G fUBWM1Aƍ|}<?t ?.EE0@ƋUtu}UE9tMM1AƃM;EsjU;UuBk#9EwJE$)ĉPuS诀]t}}UEu4EvEH}tYEEOEMAƒMu1ME4EEvE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uPQu yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}|}EE9EE}9}sIEM]u}M $$$@E]9r}u } tu u}}E EE EEMMM;UU U]]uuU})U܃}~E9EU UU؋MM]]u)]؋}܉}ԋE9E@U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwx}9}lEE؉EEU9ULM]u}UAM]9r!}tXuu؋}܉}ԋE 9r U9wMME]9]s)vu}UM]Fu}9rڃ} E@@uYE@sU PtM APt] C{ufN\}GuKE@U 9s@PruM APqu] C{u >t(F}8VE9Eu M+M E+EEEM Mv]urދU+UE9Et E+E)+U UEUBUЃq$\;] MC]Ѓ}tIu9uu}9}HEE؉}9tM]ЊC]AM؋u82MuA}9}uE9EUU؉E9tMЊAMЋ]؊C]8MuEU9M  @;Ev]9]uu9u}}؉u9tE@ @u*}tUMȀ< iv]؀; Xu~ }'}t}UȀ<u5M؀9(E]9u  @;Ev}ЀËE9EuU9UMM؉U9t}tu}Ȋ 8vE؊ыu9s%Tȃs}DEЄvEU9UM  @;Ev?]Љ]uu#V}WEPS$EMt]MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEUЉUM9sJЀ8uE]9]s6E8tu9us&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[#9EE$)ĉPuS&n]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čD#9Ew9E$)ĉPuSj]t EEqM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~"MM EBUv}]CCUBEBEtMMJEB/vEKvuFÃuމuUEBEUЉMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]C@Ћu9uu}EH9Eu MA]@%9G}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]C@Ћu9uu}EH9Eu MA]@%9cu9uu}EH9Eu UBM@%}t] 9]; u9u,}"EH;Eu } UJEH9u UB vMA@v}t] 9]uu9u}EH;Eu } UJEH9u UB vMA@L]9]uuEH9Eu }GU@=M9M1]9]uu9u}}؉u9tE9Eu UvEH9Eu MA]@EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA]@t1EU9wvM  @;EvE3v'dv}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9EsVMЊ<w <s < t A<u<]C]@EMtE8 E8] 9],u9u }}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$;EVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUMU E``HP5h#RQ賱l#ÉUWS]u=@u `<1}=@uCh[@t#Dh[Pu61 \h@5h#߰HPS l#e[_UWUװHjPjPRh@}ÍvUEÐUVSE u]t;Ph<5\QSV5\Q  5\Qj 8'SVhEP5re[^ÉU WVSE }]tNPh<5\QSW5\Q 05;Ph<5\Q|KuSWhVqKЉ0:Ph<)PV e[^_ÍvU WVS}u jVÃu!z0:PVh<7W؍e[^_ÉUlWVS]u ǃ ǃǃǃ0ǃǃǃ$t'H=vh<@Eth<v}uE<jEPEP} EP7vEP:e} EPjj薬} EPE%f= <uǹ ujP} u< tEPh=3SvEPh=/ } h=Wvjj ګ}_h=4jjV|jj蠫}Vh<3SSW|)}thCPEPRS1e[^_ÍvU WVS]h4'Wƃt*1҉ Suu uVO$h蔆07PSSR1e[^_ÐU WVS]h4Vƃu*t!J0g7PSh)=5\Q1%1҉ juu uVe[^_US]|` | `|`0t S~tV$t$VSV1]ÍvUWVSEu }V1>te8t^EEEE8_uEEPjj_tCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E cjE 1RPE _Éփu.u)08tE Ph1=jEPK!WEPE ^Ã}hF=jEPz9shO=E0Ph<jEhF=E0P5uEPE PEPÃL9vXjE1RPE^uu)8hSVE^ÃXt ] )m+Ee[^_U WVS} ƂjE 1RP `^Éփuu薂8t E Ph1=jVEPu _]Ã}hZ=jW,;]shd=7Wsvh=7W\e[^_ÍvUS]0t&08t 0@S0/S]ÉU,WVS]jSǃuh >v0E>EEPS5uuE(>EEPS t h1>^jEPE)PSt h>>8hSjhVuS} =u71hR>3Se[^_ÍvU WVS]} |hb>v08u E8v}"%?ЋM@) %j1RP[uu h>FjEP[u Et-E%U)%h>3ShWh>jS1e[^_ÐUuu uÍvUlWVSEEu EE}ttjdOÃu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}POCT JURsT]C\9mt]>ruC\r>wt>auC\w< w ЉE,>fu E>hu E UBUFu{\{\wuFj8h>EPjjjURSƃ h@INCHC u4zh@#NCDj8h>jSƃ uN{DtHC@}}}EPEPEPURuC@{@uS{\wu2jjjjjjjj5#5#h>s@C` SCs@e+CC`؍e[^_Uju uVU VSu|!Vh>j]SVu S'1e[^ÍvUS]t{\wtD{u.CHC s@h@jP蔇=@tC8C@uu S]US]{<tT{uC!|s@h@jsDUCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;#t+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsPK{t&{\wu SS{\ruS ƃ{@t!s@tt z8t{8}s8{DtsD7K{HtsH#K{TtsTKt SJe[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w N]UW )_)_tw@wjEP2)GW)UEGGuG<EuF<u@xw@h@jwDGuG<G@@ @%GDjWm G8u~G +EPURwLpGLG EW ;GLt G8EWW> 8u?_wW_wjjjGL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jPށ=@uC@jS"C8tVWsLCL+Ce[^_ÍvUWSEPu hS^߰H~PSu1[_UEU UjURPuUUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsHF9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@01{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@DFD1)@?؃PvDEPtb)ÅԋFu^|H~Xt*FFDjSv@ |$^^u;^sMQk} T+^tI~Hu?h@CFH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@ s@5 1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%P?F~e[^_ÍvUVSuVÃV à VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ V>:tst>u+C84#{PtsPB{Tʉ)PoACPsTPO h>sPIPVsP=PCPe[^_ÉU?ÉUWVSM] }u 1у?2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 Cdt?v2Љ3 COu[^_ÉUEtxu <@@@P1Ƀz t jP@pX1US]t {t{$u 2vCxtSp,ss(C$C1]UVS]u Et 81u}8t u C{ uC C({$uC$ jjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x u RS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$lCv{E ECKCPtC CCSB;Bv CCC{iE EKC8sNB))9t C/CS uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C CFCC@uEPSCpEuC C@}uE E}E ESBPSr9Cx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt CVCC@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFpR'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:CuBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBpb&Uuujjjju uÍvU WVS]}E Et#:u}$8t vtsC{ uC C({$uC$ } uE } EߋEHw(}u"~} |}  }|}~ Tvhjs(C Љƃu ,vsEF~(F$HF,MNHFDHFLU %DVPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{ut#F/~3C E{ {*S(UC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSF0%PSm F0{tV~u~u ;}u{u~t#F$v~u{lu{C|@WSDЉBwCtu ~umdukuS08vjjjS@0u$SDC9vЉu 11ɋEЉUЋE;uv1v4E̅u9uw9]r] +}̋M؉ ƋMEЉEMeЋE EЋMeEЋUƉUÉ;Mwu;]vN1ɉu܉MU܋M}t؉EԉڅtJU؋UԋM؉Љ[^_ÉUSM] EU9|9s19w[UWVSE}u u1Z@M v9tAuu 12p@M A9uu1@ u։[^_ÍvUh`u ukÐUWVSu} Cv8tAuF)É[^_ÐUE Mʁ`t[! tI tgu@t,jt@ t.Tt4tvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÍvU|WVS}u BvE]EP.EEЉEPSje }WSjS]S jSiuVSjR ^ÃuWjEPjjWj jVjjEPhVhVhVE:0jߍuvjjVWÃu 8tjEPjjEPju jEPjtEx[^_ÉUlWVS] 1jhVH}VfhuSgƃj/S@t7x9uWH9v8/t@؃Pp߀?EPWlupE%f=u;F ~>)hSWPE%f=@uW=WWP=hS! 1;/u {tf߰ҍЍD@=v?]uhWS&PS􋅜Pa} .􋅜Pq2􋅜P&􋅜PDc1[^_UVSu譵Ãt=j=SGt"j@PSƃS[vSKe[^ÍvU WVSu} ]=(u 58u[(955}3558-u!5xt,558-u55 W 5,5:tPSEu[=,-u 58u5=5;:=,?5,5`h!Whx:t$58u{s58uZ5;55D5 W;:u :P=5t5,5`h@W5\Qh?"5$5 W5,e[^_ÉU WVS} ut4E8SEPU҃u~E<Nu1e[^_ÍvUVS=Qth560050=Qt 5hÃtŃ=Qth5;50t@=Qt 5S=Qth50C00{RSEDC=Qt 51e[^É$FreeBSD$VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^É$FreeBSD$7̀rϐ$FreeBSD$̀rtÍvUhÉU WVS}u]qU :PWSuWP#‹M 99t )1e[^_ÉULWVSj:EċE8L vU:% 11E]z $XvMuV}WE xw‹BMċD|vWP! ]SuV} wGUċD`WPz]SuV}  w$GtUč MčD0WP2]SuV}  wGUċWPqMQ]ShWu NlQ)RURMQ] Su}WEPU RhWMQ]ShWu v uvtlNXP2}WEPhWU r \vMQ]Su VhW}WEPhWU r$vMQ]ShWu N*)؍@)Ɖ)ڍR9u P}WEPhWU B@PsMQ]ShWu vUv}WEPhWU J*)؍@)Ɖ)ڍR9u PB}WEPhWU r$vMQ]ShWu F@P}WEPhWURMQ] { ~ uċ }ċPrEPURM QhWW]SuV} WE;URMQhW] 3a"Eԋu P迏PhW]S EPURSQMQ]Su VhW}WEPhXURMQhW] Cދ^)ù$Iэ )PjMQ]ShXu FuPCCQ})ω$I)ЍH+vU ZlJMruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPhWQU:gu@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR N4%Uz_u]M;YfvRƩ N4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvRHvN4%U:_]M;YSvR N4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸"Ze[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvR蘣vN4%uI_tD}t;UvR[ N4%u}_uEҁvR N4%u_uL}t<}t:UvR΢ N4%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvRРvN4%uI_tD}t;UvR蓠 N4%u}_uEҁvRK N4%u_uL}t<}t:UvR N4%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFP让}ĉG$uY }vEp$UrzMq$l H]s$R.uċV$V(F y׉~,F AЉF0F kAЉF4F qjP蠭Ex@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@Px]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@Pާ]ĉC}X~ Eăx7jURMQV]sSYà !j}WEPVUrR.à uwM;qv!}WEPFPqQUƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{tsDuă~tv-}w$1e[^_ÉUWVSE E];]]U@%=Xtw =Htav=xt!UvM@u%Ɖu8U‹@MJu%Ɖu%=uEU@%=PwV=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP ǃ URMQuVWEPm 9uC]]KSURWMQuVH tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVg ǃ EPURMQWVL ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]dEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUBU8M9MEu%JE9EU"AEPn]M;Yu A4Eu;FHx >@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR N4%Uz_u]M;YfvR躐 N4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvR<vN4%U:_]M;YSvR N4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸"Ze[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjS膟EShSURPE0ËU0pSEPğEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvRLvN4%uG}_tA}t8UvR N4%u}_u}t{UvR͉ N4%u}_uIt<}t8UvR芉 N4%u }_t{wSWSUREPU2à E<ubU9UtZUpSEP腝UpEPSp SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjSZEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvRLvN4%uI_tD}t;UvR N4%u}_uEҁvRdž N4%u_uL}t<}t:UvR肆 N4%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEPaUpEPSL SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÍvU:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=>tCE:Ev j S ]E9ËN ffFC9~qEPEPB~j Sl SEP(EPSËN ffFC~e[^_ÐU WVSu EEU;Bs:vR|mvN4%t M;ArƋE8+}6v;t"WUR3!u<uڅujMQx v{ C$avӁvRlvN4%tËN ffFC~vӁvRlvN4%tËN ffFC~+vӁvR,lvN4%tËN ffFC~vӁvRkvN4%tËN ffFC~v=wB%1tËN ffFC~;vӁvR+} 7= 7t'WEP3u<t;uڃtjV 1CUe[^_ÉUS]vSdgvN4%t*vSmUvN4YvSg N4%t*vSyvN4Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvRQf N4%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$bE))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE B B 1ÐUWVS}GP U@ WJME;GGGMMzuPhrPGp3‹GPGxuEP2r‹GPNURGpv3‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BPYvvEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u Ploss 0C { uj ua!vEPC HP}SC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU B4EB4>^*v<;uSVE P@tU;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRPr^e[^_US]{u4C;C|C@@PSSC M M C]ÍvU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps muj STC se[^ÍvUVS]u CFCPs mFuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@PiM AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUhgFDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLPfǃuFHvFLPufFH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL}79';NL},vVHFL);~A9;NL|;NL}|˃Wfe[^_ÉUWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÉUjjuuu usUjuuuuE PuÉU|WVSu ouXh`bgÃtBhdbhhbjt)9Pu!SEPMQuVREP~rtChdbhhbjt*9Pu"jMQuVEPRMQ;~ks}1EE EEE%PhnbjPԷPEPPu6Gà tSSFPhqb5\Q #0@DPhqb5\Qxt?x=w'hph@BM@DžtvuDžhlDžvP88#t ~tv#8#uhb5\Q(0CPhb5\Q] E􋵬VkTPjQvvPn 􋍤QQlp80u W8=u Dž~uZt~L,0IBPu6hb5\Q D􋅬Pj~Tڐj"jjhh`vv h`hb5\Q蚐jV' vu8BPRm@Džj"jjhh`vvI h`hb5\Q}u(jhcQjDžvPzFjV>lhnbjPɳ PPQ3jЃ9t208@Ph c5\Q VXv9}G~-hEc5\QB􋵘Vi vhS։ 4 ?jjjSWAk0~u[8t)0?Ph`c5\Qb hc5\QI􋵘VvP`PPWlƃat t#vbb1ۃuV,h􋍘Qh}6'0D>Phc5\QDž fE0=vhc5\QSv}PMQVg}PMQVxg }PMQVVgjPVXg t,D0a=Pu6h d5\Q rt?jSPguFjSjf u+v􋍬Qek?Pvtu6vf􋅤Pdf􋍬Qie ?x[^_UjuÍvUWS] }1҉ ]tt8E]E8E]EBEBEB E׊/TvjjEPgǃ|7fEPWTt%UWWeh[_U,WVS]u}1҉EEURURhdSq>tHu=1>]܅t&VEPM Qssu tʋ[uۃu=e[^_ÍvU$SU] MEEEEEEUPQSjEP]ÍvUWVS}  E PuS^Dž}uhdhdT&1ۅtBEPEPE P PS^ uSv1JvSc)= :u }DžEP}ǃwSggh/dSg UgƃwdhdS~%à Vc1EPPc} 8d]E%f=t MdFvEPCPd}fd$}tE;Gt {dvEtd5@S*[^_ÉU$S]E MUEEEEEERQjEPS]ÍvUWVSu ]1ҍ} }t }tEu?UBEB5u'UBEBFB FBF B vUuuEPRuh[^_ÍvUWVS}DžxDžt|P*t Dž|jjjhPEPU Rg @ƅ4j Su0OyW~~ u; ;#]vRFvN4%t*vR4N4C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-t}uDžt@uKDžt|jPPЉtvn@u7|jPP諏tLovPEPU Ret&IPEPU RAt<+t <-tZ~uDžxv~@u&|EPjFPxvFPURzvt~~@u#|EPjFPŽtTFPURvu6kvtt?E>tPEPvЉxttxt1&WhP X[^_UPWS]U {uO{uI{ uC9Cu2EEEEEECE]ƅj"jjhPRSc }1CEEDžPEPhdu76t~5ivtLƅj"jjhWss uWPut[u51[_UWVS]9{$,eEdjjnÃ[j.SƃFEjhdPu[}HP5(:‰(:dFP5(:_(:UuduljhdShu EdjhdSDu EepjheS WE eKue3Ee'޿!et޿#et΃heST붉胺EoE[EGE3EEp D`E^vD(EJvD܉E6vϹ|]VVkrE[r@EKr@E;r@ EEdWp>TX*T:X,Eu!eWpVquE.vE+tE-}teЃ@P5$:$:t9UV$:@P\$:Ev賸EEdEe[^_É$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.1 2000/05/16 20:43:21 jasone Exp $vL$APjj'X L$T$QYai qyy1ËT$jBPjW T$D$JZbj rzju@L$ÍvUjuu u\Ujjuj\ÉU WVS]}u vV= N4%u^$tY-tT_tO.tJ+tE!t@*t;'t6(t1)t,,t'%CVffPjS~vV= N4%u<u t/u t"u t t/Fv u"C\E@9\0 $f\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv V; N4%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQlu)e[^_ÉU WVSMu ]}MvvFPWRQ KwtjWPQ+Ee[^_ÉU WVShIDžu1`u1ې[#0:Ѕt;9v,A[,:4:u BA:u[0:!Cve[^_U WVS} t E }t UUEE8?1v,:PWClu84:t}0:U v} tpv0:U _v,:Wku44:t} t/0:E "}tv0:U  FFu "hgEPGǃ 1e[^_USj 3HÃuhgjCvCCjPHuhgj؋]ÐUS]SB9Cu/BCP3 uhgjǮvKE C]ÐUVSutA>t3} t 1;^sv4WHC;^r6DHV8He[^ÐU WVSu} 1;^s$W46juC;^r1e[^_U$S]}hB]UBEPRj&t1Kv8t E}t@]ÐUWVSE NjU{u3f~}u,f~u%7E?vWEPE PVS1 tރj{S Ãu҃WE PVe[^_U WVSM] 9tf9uf1qf>tTf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>u"EPURPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;uvrvGltOdtf;,tY9sf9rFfN ffuEPURPUK92E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM(5uhl -uEtQNu'8POvU RNu9HU ffA9s9u9sffufE e[^_ÍvU WVSE PhSURƋE ߃?*v[!uf>tj]FP uf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffEPU RPutU 9u4B uB %=uEPU REP<4U B u(h j+PBBP71[^_ÉUUE 02JÉUEf8tuu PEPRR1UlWVSu ]}Evf;fWEPEP4t 1G taf~/tZE%f=@t,f=uFWEPEPju.E%f=@u F;Ev vf/fFGEPWEP)f;t3f;/t-f:}EA;Ewff:tf:/uӃ}u5Ήf;/vF;Eoff;/tEPWRSEPVEPe[^_UWVS} ;}wwfzUEPUR`ƃucExtRhPURu&+U0PUBЅu E@ t v1DžDž| UB @Bux.u Uf:.ufP;]sffBfuEPURWuf-E PUREPURSEPh uV҃tE@ @tV‹B V?[^_ÉU WVS} U:t;~SGtPw% P$Åutw$G멃u"~GH|vIy_UEf8t fu+EEP#ƃt3EPVEPtV\$ vG4G1ue[^_ÍvUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=>tfM:UwBCf9v05uVPCPVEvf;UuEf]uE9E(f9f?%e[^_U WVS}tBG_7Ntv;t 3y"swc"Ge[^_USU] f:t"hPRet19lfC @uP7vPC ЋÐUVS] uhPutXP?+vF @uSP+SPF$Ѝ[^ÉUVS] uhPuxtO?+vF @uSPV+SPF(Ѝ[^ÉUUM v9tfu1US]M UJtAu1 s[ÍvUEEEEjjEPjjEPB = ;t5 ;4 u& ;tVjjEP5 ;jEPB |U% l;5 ; ;1UWV= ;uu1_;;;s@`5 ; ;=`tɃ=;u5 ;R ;`e^_U WVSu= ;u t{1C;;sCV[ ;P"Au;;s[`5 ; =;u5 ; ;;;r1v`e[^_ÍvU WVSu= ;u tw1;;sD ;9p$tC;;s/[9t$u;;s[`5 ; =;u5 ;  ;;;r1v`e[^_ÍvUS]= ;tu5 ; ;;;]U= ;t5 ; ;;ÐUÉUu&1҃u‰ÉU,WVS}u EEEEjjEPEPjEP? }s1rEE$1;]}Mv]jjEPVjEPV? }ZK8-t(vFPW>tC;]|1Ke[^_ÉUS] =jjjW*|*=~*S55-*} 1_=t5@PtS55)|9vE]ÉUS]=du/jh$}J1"d1=t]ÍvUEPUWSEPxÃ}u.߰;U ~ E"vRSuEe[_ÐU WVSlhlÃ; j EPS&ƒuE8txu~Ev)l*v@Sh+l节9~jhAljځ%h[lMlڃڃWRhtljhglЋUHE e[^_ÐUEEUBjjEPhjR;t lÐUWVS] tG j(ƃ1 EF ^$EF$tN$UR=vMQPVjhlV!EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhlVt?MHf@4 F$ujjhl+F}N$?EEP]UR vV1e[^_ÐU WVSu] C&fC$GP{@Wv藤j/Wƒ t09uzt&BװЍxPRC@PWf{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃRf{2}߃S~tvJ ~tvvF$uGv#t 8D1ۃvtVgD VO1e[^ÉUlWVS}?G%7V8fF8ujVW fF4QvusF4ffwejVW fF4fG$jjhlمF }RCFfF4N6vf~4tG$@tBF,;G t:F6tv tw GfF4vtbG%tg%w Gt=vjVW tRBFN6wt=F@Fvu*jWMGuG%1wGvPvf~2u,G$uw!VWf~8tf~8uXjVWfF4fu9G$u3jjhl*F }AFfF4N6fF8OFP$@|/uT F@$/BF&@PF@PR跠pPf~2u"Vy$AvV$Gf~2uG$w evF6tFG$u0v y t@v @-vv y'vF6uhljvW t O% ~tfF47e[^_UUwE fP81v3@ÉU WVS}] tt@7?G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjhlׁƃ|.SW0GV uV Gv1e[^_ÉUUB} u E8UB$u"EP0U؋E@$ uUEEEE}u} usjU2EPURStL}t} u +>UBEH6E>EUR)EvE vEUB$EBU|/uJUE@$tUP/BU EEEx+}UR2BUEEEE E@$ u#~.u~ F%=.FPFPURcÃt-F9UzUDPEPtQ<0t S-UREP(UfB4EH% <01U;ztEB$t EBE̋Uz+}FE= EfC2UCfFEfC$~uK6}t(}tfC4 ECfC4 UBC}t}t(~t"~tC@UB$tCCfC4 bE@$t#CCC&@PC@PUR#C@CjSURfC4}~fHfvf{4uMC}u ]] vEX]E}t.UR1ƃ}tEP '}tUREPvUB$tE;Bt}uM̋U}tm} t }Efx2uUB$uJrgu!6hljEpURtEf@4UJ%}u^} Ef@4S UR EP&UfB4EH%#:?pUz t}~EPUREPEEe[^_ÍvUlWVSE} ]@$u_E$Ft vB:uCtBIu[^ÉUWVSE} ÍpvCvA8t uv)[^_ÍvUWVSu >=uFHEEPUR"ƒt5}AװH;EFBu1;t vG;u;u-PRÃ@PÃtlPS5ܰD}UB:t:=u+EUDPU u8EBMAMt:=u=BvFBu1e[^_US]EBuEPSuЋ]Ív$FreeBSD$ST$L$ 18uBu[ÐUE4<ÍvUWVS]j(ǃ6hƃG <w$ N PV@FO WGFj8P8EEEE EEE=4<t4<9~؉E]EEjhXP@SEPSXk uD@R@ЉÉ^S‰V t/XSPRFGFGW5hx5\Q聂1[^_UWVShPu/vE|xxPjÃ}v~19}2:A9|PSxP|PPX[^_ÉUÍvUEU @$JPRA ÐU VSu} ^$juuEP/{tsCC PEPtC CFCF4vEC PEPCCFCFVfe[^ÉULWVSEX$@;Cu 1CEEjssuVZUURVhǃ tajEPwEȉEEEjV@Ѓ EPV|hǃtUCBCBREEP]S=hEԃxt S@Љe[^_ÉUVSu^$s{tsov$a~tvMVAe[^ÉU,WVSu]~$jhGPS!VS tF PSuhy[CS@ЉCxt S@Ѝe[^_Ð$FreeBSD$YB̀r tQvUdSU] tC}uUfEfEUUEEuuEPY…tEЋ]ÉU1ÐUdWEU fEfEEEǰHEEE4 EEEPREPf}ÍvUSu*9u9t7T]ÍvU WVS}(u =Qt W>#G u!jjjwG(ЉÉփu u=_PwTG tG)փ0t#G<)G t?tG)‰Йփ=Qt W"؉e[^_ÐUSE8eX ;E{tsf{tsR{ts>{<ts<*{DtCDP{HtsHS]ÍvULWVS}uE@yEP EȃuURhMyvM1gy }1EEEE %PhqyjEP]9EPEPEPE03 t(PpPhty5\QG{MEԃxt(hphUu4EPjjjÃu hy?Ãuhy ujuD tjj0uhy跪hnÃuhy菪hF~ j6Mqu60PEphz5\Qy hU2gy uJMQEPu3UȋB Ez8tEj/MQMjURh#z%j/EPMjURMQh&zU2UtPRMQF00PEPh)z5\Qy hu]j蟕E̍e[^_U WVS] }u}FE`<;v`<PRF~܀;hz6ƒ}t t:uE4@<ƒt:uhzƒt:uzװHREPS}4@<ƒt:uװHbRPF~(}t:߰H SEPvj/SESǃuD߰HSPXF~/uG/tvtf)؃z@PSPF;/u C;/tG?t?/u;u!PRF~܃}t&UR1v`<P RiVP umtE9}LPP)S uzfSC9|U1F^ e[^_ÐUSh<hv`<Ph<4t=hzh`<Ph C~ vC~]USuKÃu1 ?]ÍvU WVSE`<U.u~~.u ~j/VtP=u~hzÃt^uU߰Ѓ+=v ?1Suj 1zEHw9$z 9A 1 )H ! @  19URVot!VӃu1VEPEe[^_Uhjjh {5huu&=u @==u @=ÉUz=tUPWSUE]CE8װHPREP}WjS |muuuu uWe[_ÐUWVS=,u qt^=lt@ 0E2j]EPh0Н]E@P~ u18+t8-uu=T=uhhuqװHPhRR@ hs8e[^_ÍvU,WVSu=,u ZtE1Ѝx~ 1vW]EPVÜ]EGxPtà u3=T=u=T=th{VhÃt8+t8-u1ۃ=4u91te[^_ÉU0VSu=,uu1E3uj]EPEP]܍E@Pà uD=T=u=T=t)Vh&{j]S-h){Shà t8+t8-u1ۃ=4ub1te[^US]0lt j@4]UjÉU0l=,t,P@,=L=t"L=P@L=P=T=ÍvUS,B{t6{jjjjS, t #=uShO{jB1]ÉUVS,jURuP@ Ѓu3uE;v/P5Vu 1vFCuFCujVhfjVh f jVhfFCuFCuFCu FCujVh$>fjh(Ve[^ÍvU(E4EEMAT=,jEPQRB Ѓu{ET=Gu7=uhWuG5T =L=ujjhXjjL=ÐUWSUEPEPװHPRhV{5cT u]uuh轵Eu] hl{EP)thl{EP)u1e[_ÉU WVSuE ]}8+8-SPh2Ehl{EP9)à N(hl{EP)ÃF(u9u-hn{SKEt6tF^N(hl{EP(ÃZF(uS`FN(hl{EP(Ã#F(uS)F N(hl{EPA(ÃF( u^N( hl{EP(ÃF(uSV>FN(hl{EP'ÃF)uS>F$N)hl{EP'ÃtNF(@u^N(@hl{EP'Ãt'~(|^N(hl{EPZ'Ãu1)F)u^ N)j v EÅte[^_US]EPhq{SXu ,t#uEPhV{SXu1]ÐULWVSu ]=uhS=uSh{Sh{hP&PPHPVP5P ti=Sh{hS&PPHPVS59P0<=l4j:CDžƅ5jWPdCS u9ƅ2jWP"S M8+t8-f.=7x@5VjP uSPnÃC 8VC 0tC C 8u=P=ЍE@PVD=P=hЍHBL=jhD=RP@ Ѓ9%8-x@5VjP uSPRÃC 8VC 0~tC C 8uP=ЍA@PV,lP=ЍHBL=jhD=RP@Ѓ:17:5uÃe؍[^_UWVS{=uhN=uq{=luR=t5EPEPhhV5Nǃ uXl>EPEPhh5SV5Oǃ Stl1vj:u?ÃtiE=P=t;EǰЍUHBL=jhD=RP@ Ѓu:!:5uuEPTuuue[^_ULWVSE8+Cǰuh5aEx@l=\=\=@ 8t{=P=t@EǰЍUHBL=jhD=RP@ Ѓu \=@ 뜐h{\=@ 0há\=@ X=l\=1v=X=uEPX=EPEPEPutVE PWt8u)9u 'C;,tP>uEE9r1e[^_ÍvUSM] UE8~1mt)tVt't>JЅu{PSh{ Sh{Ѕu{Ph{QFh{Q6]U,WVSu}}EP=lDž1hD~PP߰HPS{t{P5zBǃ u5EPǃu&PEPuE PSDYEP} t"tE PuXttVu5}t"tEP`u 0PPPX1[^_ÉUWVSu`=tsVuuVÃt{t nCC EV8ME8(jZÃjSEXh=h=E h{EPEE]h{EPƃtfF> t> th{V2t)H~4XSUMSPV蛃 EUE}f#h{EPSƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv==uhIAPP}HPURh{5> t/=lfEPh{hPM 4+uv;#C; t; tC; t; t ; t;u)C; t; t; ;j豿@FP蘿B VPW聁B߰ЍpDž| uN|\u NDž DžDP~/PRPRտ VPS軀tN5p=hWtЍp DžB `=`=URp@u C=5p=hPI5p=ă1[^_ÍvU=u t=uMjjju1M8+u:t>#t =0 t|\u0 v|\u'0 %vn8?0 CB:t ::t:\u1t:CP5,  ƃuV=, tM, @ fÃt85, T, C&DLt(|t:tAB:t :|t::ujjPjE PPEP,ÍC wC[^_U WVSj=u ugÃu sjd2ǃu KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$4|@v 8v 0v (v vv:vCCBMu()FdPW`ǃEd>;:t;t;^C;:t ;B)K}t)PW>`DžE8؍e[^_ÐU WVSj=u uÃu jd芞u, mvd.vCBOu")΃FdPQ_tǿd;:t;uB)Kt)PQs_tE؍e[^_ÉUSj#u u…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPu_^e[^ÐUSU}t vAzu$)ĉE UECtABu5Su<]ÍvUSU}t vAzu$)ĉE UECtABu2SuЩ]ÍvUSU}t vAzu$)ĉE UECtABuSu*]ÐU5u uFÍvU|WVSDžj/EPtEDžIE8Hh}Gƒu}װЃ$)ĉu R虩8uDž}Ѝp}ЍxD7=vBjh}j=VPj+ jh }j vVSPU\/WDPEP?\D7 5E PP藧=wq$<}1ҋE 8t BE <u$)ĉ$1}D$PCPE P[5Sh4}CPPǤu uGDžh}P=@t vx[^_ÐUEu\Q8 ÉUE< ÍvUS]EPu r0S:US]uu S0SvUEPuu uUVSu]=8 u j_5`h>~58 o.t(uS58 R1hC~58 C. u xPhF~58 !. =< tV< ЃV蒢UEPu uUVSu] =8 u j5`h>~58 -tuS58 0hJ~58 x-=< tV< ЃVUE Pu0@ÉUu u0!ÍvUEPu uÉUS] =8 u j5`h>~58 ,t(uS58 /hC~58 , u*wPhF~58 q,]UE PuÐUS]=8 u j 5`h>~58 ,tu S58 .hJ~58 +]ÍvUj ju+Ð$FreeBSD$ST$L$ 18uBu[ÐU`~=( t@ Uh@ j:j:hs5, h( u UVSu]=Qt VSu VÃ=Qt V ؍e[^UVS]u 9sHr1"VsD`t CDsH1e[^UWVS}W wj 7VƃtF)ËU O )_7_ECPPWO+EUWDP7R1]W艼 uVwj 7Uƃu_롐F+EÃSWu)EGDUR7PИE)G7U GD E 1e[^_ÐU WVS}tME8tEǰHw/}?.ut!.utj/EPpt vutuuN`BN1B=` t3h@ }Wu` Nd N1=hrÃtepu\߰Ѓ+=v ?S_su-8t  5S腠hS }WSӠhSŠ hS^ƃuZ8tvVu*)8t vOV莻V1t uP虖uPuPqĀuP ^vȀuP .v̀uPÃOuk=` t;` pĀuL 5` ҐN` Nd }Wh@ :P虐؍[^_U|WVS]EPCP}}S u@EtcS"U;8tEP&SjuЋUR/t!蘾MQڏ腾1uuEЉET L EՀt PUB0B0P P 4 4 < < D D E׃4Ӂ4с4U::  E}~NjML 8 4 ЉL u9v EPML @ < ЉL u9v EPML H D ЉL u9v EPEu8 UDD DAuTL)AL D L E9L )I~0}D; IED EMU;4 IEEu;< }KU@ UDDDDEuM;< |EUE;D }HMH UDDDDEu;D |UP L ;Ev(MQ vuV蘌COEP u ǀL U4 u ǂ8 M< u ǁ@ uD u džH Ex[^_ÉUE@(X @, NN1ÐUVSM] uu NP05Av ww NP0I  At[^ÍvUWVS}] E~9ust/'tV~ CJ[^_UUvRz%vN4ÉUUv Rz N4%%ÉUUv Rfz N4%%ÉUE%UUv Rz N4%%ÉUUv Ry N4%%ÉUE=wB%1UUv Ry N4%%ÉUUv RNy N4%%ÉUUv Ry N4%%ÉUUv Rx N4%%ÉUUv Rx N4%%ÉUUv Rnx N4% %ÉUUv R6x N4%%ÉUUv Rw N4% %ÉUUv Rw N40%ÍvUUv Rw N4%@%ÉUUv RVw N4%%ÉUUv Rw N4%%ÉUE=wB$%v1UEÐUUv Rd N4ÐUUv R N4ÐUWVSE@(" @,# L u O:vUL C; t; tj$sƃu"8t E1vjEPS赑;]]U;0} 0EC; t; tjEPSjF;]t?]t8C; t; tGwjEPS,F ;]t}uV芅O&vEL ǀP $NUN1e[^_ÐUWVS]1} tCNL }%tu 1ɉ΋ ;M v}tEN@0Pv|$~Iv CI}tENL P ! [^_ÉUWVSM] NL #r Љ!;ruKNL p9urp}t EJ CJNL ;pu09uSNL ;pu$p9us}ttEi6vNL ;pMp 9us}tt9|WS~}-E =>tGUE9|81VWF}SV5 UEF~̉:E v!e[^_U WVSE@U9B0uEhtƅtvEp0@4ƒ@7OyU21KEx4?URp0Dvƃt#7WVSyEp0UP41ve[^_ÍvUVSu] =u_=Qt S9C u2C tOC t"S_u9c CCK {0tCC;C4|+St=Qt So CLvc ߃{t;Cv@9u C)CC<C8C@C0C4SBCBC=Qt Sme[^UE@(44 @,p5 NN1ÐUWVSMu} u|1%=u~%=u^%=u>%=u %=u59] st$ !AKt3v%=ttAN@0)$? AKuСN;P0t9}P0t[^_ÉU WVSM} uuEsvu E]u EIu E5u E!| Et1@9]st3+vS~$? :J Et߉>[^_ÐUE@(t6 @,h7 NN1ÐUSM] Ut=9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA N@0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÉUVSu] 9u1'  h h u)؍e[^ÉUtSPޑ\EEEE=pt'P E܉ƃS E؉à vEEvEE>t)}u#}WEPEPVq u>t}t;t+}u%}WEPEPSA ];t}t}t-}t'E;EuD}u EU)‰U>t;a>u;t)>t;uU+Ev>u ;uEEUR`nEPTnEe[^_ÐUuu uÍvU,WVSEEUUEUvR]vN4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjj)-EUEURPjj,EܾEE©v=wB%1tEnUvRw\ N4%]ځvSC\ N4%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}胚"v}tރ߃} tE}tEHU e[^_ÍvUuu uÍvU,WVSEEUUEUvRZvN4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE58=<}t 50=4EURPWV-*E܋EURPWVD*ƉEEEE©&v=wB%1tEnUvRY N4%]ځvSsY N4%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}78<EU}t04EU芗"}t ]U]} tE}tEHU EUe[^_ÉU WVS]E 0ESUR3dtr;;}w1u9sE8uU]߅u`UttOu SgƋE 0uh@5\Q&1`SjVk19s(}t"jVURU҉EuC9suߋE8uU 2gE Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÍvU,WVSuZtu\u>2h EPu>5SGthbSt }WSthdSt hpSR2u vPjj EPHtWb{uruwu|ItlWjjPttWÆ*PƎ=Odh jdƃu Wh7du"ՓVePUvPcu8藓VdWd PWjh Vt@CVdPyd WgdPWjhP:t.V&dWd PCPSjW9tO薒VcPc WcW YP}Wh  q =|t5|bc5|=tt5tBct=xt5xc=xp1ۋ5|C!9u|tp>1[^_ÍvUWVSuHEt>uh|E}EUUR]aÃuh}jGyE>t|u؍e[^_ÍvU WVSuE UEx;tV:uF߰HPSVu#߰HU C UC$;utЋUtDUe[^_ÍvUuAuhjGÉU WVS] k0`װHPRj6jjhj%j ډװHPSjjjhji V@ƒӉ߰HPRji jhjiEPiU WVSuu u1=QtEPۚEx}@u}LSE0WcE)ރP t$=Qt EP蛚E)1u [ ǀ$>^ uvƿ tƿuǀ >l ǀ$>Dm /ƿuǀ ><` ǀ$>x` CP &PhPK%P|,' >$>C~卥[^_ÉU1ÐU WVSu Et~uVjjjd} :Pajjjc } vPat$jjVcPa=Qth>_1ۿ ><8t/URVUR8Ѓt=Qt)>C~=Qt >1e[^_ÐUWVS] }tttE1vEPEPj0u"EPEPEPSGSEPEP|3uxt[ut;Jt2EEEEfEjhEPIZE1EPEPEPS=`+uEPWSEPƃuu{utktbEPWjEPÃuEPS$5t!36xtS1ۃEPSVQƃVKe[^_ÍvUE Utt 1 RuPu ÐUWVSuE}t }tC} tUEt]E PVSGYރ>} ut]E PVSYރ>uk~u~u ~ >uP~u9Ft(>u4~u.~u(~ t"9F t EE =`+u&=Qth>p\1ۿ$><8t/URURU RV8Ѓt=Qt(>C~=Qt >1e[^_ÐUuSÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MXtEuEE‹ETRREuE 1/uU:t*M12Vn`ƃ vUEEMAUZtLE;t@8t0MAU4BU3V`ƃ;uUBMBtUBMAB A qZtEEtE;t2vUBM4AMEp 3VVu;uыUBMEe[^_ÉU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43u9u  G ;u((~EUB U ;B t$@@ !vUB$BUB $B l$P1Dž(vE (uEXE (uE@ $;B u5;lF;u;tz,lT 8ǂ,ǂ0fǂ4jhD9 PSF;uv((lu$P*$UR E P$[^_UVS]u tP{uHjMt/@@@ @VSP 1e[^ÐUvEP;E,vUR;E}t U1e[^_ÍvUU t>t Gt>EE@E EE@EE@uPu|ÉULWVSDž:DžCDžDžDžDžK}uUf=}t} u}Uyv}1EEEU Uh39M.1UE t}}+9}2)؃A.A%A.AGN;} |ԃ2cv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AGN;} /0QVFhRj jPǃ }MwpEP]Sj PWR tQQM8EEU UMEDžURS<2M8R71[^_ÐUu |}t ÉU%YÐU WVSu] 1EPs=}1YUvtz tB xu@9uu 1jrSuCe8؍e[^_ÍvU WVS}u =>5>5+FFÅt9{utVs Xuك=u7F>>؍e[^_ÐU WVS]ufu u ctSE PEPh`hWjjjSE PEPj(Ã0~"@tEPhWSr Ã%t hz'EPEPSPHÃ}&t hFu Ffuwt!F%PFPhFw-$І" v؍[^_ÍvUWVSEEEEEu u vKc1E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE9r5EPUREPU RjEPY CUEu=|1۾Ŀ=ĿvEPUREPU R6EP &b8=t t%"uEUBuECuC>ty}u/u @u"EPUREPU RjEPL=}tU'v}t}t e[^_ÍvUWVS]u uu t%EPEPuPSh uF߰ЍpTNx <.uVSSZvR߰҉ЍD=~5VSh$P5uuEPEPP[^_ÉU WVS]K;h**3ph6PǃUjWYE!vR vN4%@uF>ù>SP|FvR+  N4%@uҀ>^~t4vRvN4%@uC;u/hVh+W&Y+.vWhP?WX1[^_ÉUU h%PRuÉUWVSu}}t}w} mv=Qt VRjEV~0tF@9F0tv0/F0FF^ }v.\}taEPEPV Ãu E }} uZW-E uDE;}t}W-E } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vF=Qt ViEe[^_ÉUlWVS}$u(uu 8t EPURE PURh@  GG}ffE$gG$gGg_ }Em} }tz}neEPEPVSU R D)ƃSEPNSEP= UfB} }EPEPVSUR` ÃSj SEP SjSjUfB E 9|vCSEPSEPo SjFSEPM }tEPURS/]UfB )e[^_U WVSE} u}8U)‰Ѓ nCSj)~SPCCSj SjUB @fB )e[^_ÍvU|WVSDžDžDžDž=u =u u f=u t f5fjhh=.% 3hc+ƃhVh5ĿȿDž=t|=ܿsa= tXv> t> uDž%vt0DžDžF>t%=ܿs > uF>t> t > t> uhohq8;#jhPT t  p t  u F> t> t>B> 9hVhhh迗ƃ tDžjhP蒙+ t   t  u F> t> t>> yhVh<j h螘ƃ t5ĿȿDž=t[=ܿsE> t> uDžvt0DžF>t=ܿrF>t > t> uDžj hPF t   t  u F> t> t>6> ->t8vRvN4%@FC;uȍ1DžDžj5hj SxPPSV zzw"rrP)1 󫋕zw#rrPF).DDD 2jhP^W t  A tF> t> t>^> U>;L1vRvN4%@u(F>t"Ph`Ou >;t>}PWjQh`F/vR8vN4%@uF>t >;t>}PWt"􋝌ǂUPWj=ǂ    F/vRvN4%@uF>t >;t>}‹&t/u+W3ƒ SWj0t|*1vy ٸCGv؋ǀǀ HjhPu) t  uhPRhP_ ~ %􋅠PI=uChS%u(j.S輑ƃtFPh-uĿȿ9*t $h"ƃthćV 1x[^_U WVS}u VSh#{vC; t; tjhSMuRCPB1$%  Ph DvjhSu9uVWh u hA^jhKS蔐u  j hQSpu aj h[SPu Aj heS0u @!jhrSu @C;t; t; u;e[^_ÍvUE|)%=tÉUjEP$)+‹E3E1%ÉUEv@>ÍvUVS]s{tsStu׍e[^US];tAEKj EPSK8u}tE8u1]ÐU|WVSUE}EEE]ECCC CCCC}u} u (zzzzt EBtttEv߉{tZ{ tTE=|DSE;u-xt'xt!CM;AuC ;AtE CEE8}% =t=Iv= u {tcv{t {t{uB}{uCE PSS Eߍu}E=.vߍuE8CU;tBt :CM;AtAt yC U;BtBt z{uMC{uExt@C{ uUztBC }uEPM QSEPE PURSwE}}tMytE@EtxuEU:}CtEE}uE1CtEP  vE=ߍuCU;C;BtBt zC M;AtAtstyui{uExt@C{ uUztBC EPM QEPSE}tUztMIMtyuEE81}tE}u}t EU1$E}t uMEx[^_ÐUVSu1ۋF=t:t @8t:u#uAt 8tA8uAut;u1v[^ÉUWVS/1ۃh&h:vƿ(t9ƿ.t&ƿ4tƿ9u|> Uvƿ?tƿCu|>ء ƿHu |>4 CPz7&PhPP?||>vC~[^_U WVS1EE=Qth>OUREP(t=Q>=/u 1ۿ|>v<:tgEPE PEP:ЉƃuJ]t#vjURSƃu.[uᐃ=Qt >EU1-C~=Qt >}t ue[^_U,WVSu} EE]jjv }C8t1vP{WVuكvttpPVCt#vpPVkCu %jWsÃu EUb}t u؍e[^_ÐUEEPt ERu}&EPa ǃu 1ɋ]St~؉]BE1;us?ËC#9t,؉]F;us]C#9uωt}u ~ ;t}MARu}tiE9E}?uNx.D;D ~$ \DT TL\ NyՍvE]9]|U1;M}vωBA;M|BWJ 1e[^_U|$WVS] }1҉E]}t}tqv}aUBȉB] f􋅤+PPSRMQ? 􋅨P\}t}t }uAщUDžDž;􋅤+PPSRMQX 􋅨PSSƃ St v}t}t }hVSRMQ |FVt6щ+9~ C+PPRv}u#tmU9tUvڃ􋍠QU#PEPH#Pj~#PURhj%Nr0딐t BQP`xt)RQh`j%qu !u  u(ǰ}u󥃽u E vEuSPEPqBut'yt@txu v_ vu~;s Tt{t)}u#EPC}u=KvuURuMQ PuUREv1x[^_ÐUlWVS}1}}]h<ǃt h&Eu WvUBtY tt[yuEE}EMMĉuEEEEEWvuEEuEE}E#vW[UROEPu y}"W%MQvEPuuuW tCt [t{u}t#URuuuMQ| tCWEP}up1 UE1e[^_ÉU< WVSuEPh Pǃu1o~Đ?#thڌWsÃth݌WsÃtDžCs;jv; t; uCCv߃uh݌S1sÃtCWM QWst;u}1FEEEEPEPhPt;vFCF C tQSV:[uȋ[^_ÍvU,WVS} E]h&h`ƃu QCtt[t{uEPWVu҃Vu+}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REP7Cu ELUt6sRE؃u,[t{uE܋FM܃<uUE1}t uWE؍e[^_U,WVSEEuu hEu} TwfGE_ GEGEtSEPEPhhEPjjjSEPEPj;Ã0~%@tEPhEPSÃ9th7EPvEPEPSEPÃ|;]~fNFu Ffu;FEt9F%PFPh%F%E_?EP!}uS}w=E$@vbRB2Ee[^_ÐUWVSE @EEEEuu #-1E8t 8.uG@8u1;Ev x.؅u'URtU RP+SE9r(E PjUR5EEu=|1۾Ŀ=ĿtzvU R6EP&,8=t t%"uEUBuECuC>tt}u#u @uE PjURH9}t E$}t}t e[^_ÍvUWVS]u uu tuXPSh^uJ߰ЍpwXt#N<.uVSSdZ߰҉ЍD=v2VShzhPN uP[^_ÐUME EUB EjjEPQjRt1vÐU WVS}EP(}1W1]t){ tC xuWs#u؋C puu )e[^_ÉU WVS}=>E >5 Wv6Wt&^;t:3Wt ;u} t!E Pv ot ƅu=u >>e[^_ÐU\WVSEEE1EfEEEEEEE]jjSjjEP3 Uu}Eԃ<jjSPjEP }2'8 uF~ URMQ,E}pEԉEE9EyUЉUȀzOB tc=BtHJ fMEӃ`z`tB`$U܍TUEEPCM؍LMfEEȉEf}Uf9P t|f}MA΃EE1vG5%M#At>t ÃuƉ]1v%U#Bt3>tÃu:u MM]G~UEЋEE9EEEE؃uMEPjVE+EU܍EPIEuMQ3EEE+EU‰UU܉UPjMQEEfEUԉUЃE9vMЉMȀy\A FFF fE˃`UŰMJUЋBMACUЃhPREPCUCDEEMA UB`PSMQQ EЀx`tB`$EEEeEMA}PEpfEqMȉMf}_Ef9A tf}EUB8M̋AUBABBuăE1G5%M#At>t ÃuƉ]1v%U#B>tÃttktKcEMA SVPFvEMA:uURjP[MM&vSVEPMUJSVQ]GFEUEMEЋEE9E|EPDEU9UrMEUMQ1e[^_ÐUuÐU WS5>>%PhhPF>> =>uh>rPP߰HPSh5>p tFu;PP߰HPSh5>Yp t19hhuE [_ÍvU WS=>uh>q5>5>hhSkE>> PP߰HPSh5>lo u9hhuD 1[_UVS=>uh>qt1=>uW=>t5>EPEPh/h>h5>qƃ uS>Wv>EPEPh/h>5/Sh5>urƃ St>10uuhhuC ue[^ÍvU=>uhhk>5>~E ÍvU=>t5>>ÐUVS=>th/Rt /=>uhhɻ>t!5>hh/9ƃu1e>+u[jytJ=>th/'=>th/ h/P>#nhV^ÃS53hōV^ƃ/F> t> thȍV^ÃCV%3343ƃhōSR^ÃtBCt<;t7; t/; t*4svhōS^ÃtCu3e[^ÐUj juÐU WVS}u hVGu#GtSPhV uNx   Vj e[^_ÐU, WVS]E#=tEx #=? ?1PVE PEP70tp8t0Ph8+ Kx  Sj 9u1t(tWE PVPhS } uMPVPPPtPhS葁0jhPjjPEP} }"0Ph7SD&SPSj a F|[^_ÐU5XQuÍvUu huÐULWVSuu|EPu u#-}$02PhKV~@]#? ?E#@ @U}MމMMMMMă=t ut R4@?4?h`V =t t)NyF;F|;Vj;=t IhVE#? ?thV{E#? ?thVTE#? ?thV-E#? ?thVE#? ?thV~E#? ?thV~E#? ?thV~E#@ @thVj~=t t{WSjPhV:~EPSjPhŽV~ MQSjrPhŽV}EPSjTPhŽV} =t  t"Nx Vj Vjj]SVj jS Vj@jSVhjS u1}u+}u%}uNx  Vj Ye[^_ÐU WVS}E ]hRWURP蓵ƃ }1Iu+KyC;C|.!Sj.vSPp>[^_ÉUuhu uSÐU WVS]EPSEPEPu ƅ|&߰ЍPt|.tB;E|1fEe[^_UVShVhu ujà tuV虱1[^U WVS]} u{t)sWXVu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRh•h40t4]USEU ]xt;ut@, xuRh•h4t4]Ujuh0ÉU<} ujuPÉUjuh̎ÉUE= wbw+wB2 wv@=w/=w=== w=v=@=@ŕʕЕߕyqiaYQIA 9*14):!GPhMh44ÉUS]j(h 5S/}ShUh 5 5]ÉUVS]fо f1fʃf1f<>Q)QRhXhH5 H5e[^UWVSu11ۋ=wB%1tTPAѐ9.u]A=wB%1t8A=wB%1t\A1;>r>G;\s14> ~ Љ%[^_UWVS1EEEEv=wB%1t|PCѐvR4vN4%@tCύv=wB%1=wB%1tETPЉUCˍvvRvN4%@tCύv=wB%1J=wB%1tETPЉUCˍv;.C=wB%1t~EC=wB%1tFUBEC=wB%1tUTЉUCvR`vN4%@tщvR0vN4%@tCύv2wt$d)U4)U4)U4<+u)U)‹E)Ѝ)v12w"$0vU E  U CvRB N4%@tӉvRvN4%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=wB%1tUtBōvE8.uyEE=wB%1tOEEEE=wB%1tEUTЉUEU]؁ÀvEvR% N4%@u 9}sEȋEvR N4%@t9}5E9}'EP#EEvR N4%@u 9}sEȋEvR] N4%@t9}E9}EPEEvR N4%@u 9}sEȋEvR N4%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUEPP6ƃ u5>EPPà u>SVWEPUREPMQEPURMQEPEPURMQEPh U RP;=>t W;5>t Vx;>t SdE e[^_ÐUWS]߰ЍH119} <.u@B9|;*utH~| .t@[_ÉUEEEP褏@l@0ppp pph_hT5T5ÍvUMU uuuu PPP`:tPA)PRÍvU\:WVS]E(U0U$U Džt3URPFuE4PE0PjhbOvE,PURƃuE4PE0PjhfvE4PE0PVEP},tU,:t E<u,U|2.t"E4PE0Pjh`LFE4PE0PPjV u4u0S ǃE4PE0PWURwPuPhk]Sƃ0E4PE0PVSE4PE0PPj>P= EH"A$@}$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhrGE4PE0PRlE4PE0PE,PE PU REP E4PE0Pjhr{E4PE0PU,RE PE PUR PE4PE0Pjht1DžU )ЃR ÃE E4PE0PjhxP Sh~]S#ƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj hm Džu [ÃE E4PE0Pjhx0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj h* Džu 誡ÃE E4PE0Pjhx u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjhy Džu ÃE E4PE0Pjhx< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj hZ Džu HÃE E4PE0Pjhx u4u0Sƃ E4PE0PVE4PE0Pjh< E4PE0PPjVg  E4PE0Pj h }$b u kE Ph]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u E Ph]SMƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0Pjhr E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjhr<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j^E4PE0P}0HPk  Su E4PE0P߰HPSv}$u ۜÃE u ʜE  PShhSƃE4PE0PVS E4PE0PRu ƃSu E4PE0Pjhr ZE4PE0PPu ƃ6u E4PE0Pjhr| E4PE0PRu F ƃu E4PE0Pjhr0 E4PE0PE,PE PU REP }$ju sƃE u bÃE  u NE PSVhÙ4Sƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0Pjhr% E4PE0PU,RE PE PUR }$^u4u0u jnE4PE0P}0HP{ E  E Ph͙]SƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjhԙ Dž RhڙPƃRWVP Ui9E NE4PE0Pjhޙ}$u E E E E E PRQh]S#ƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhbDž Džr19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu 胗ƃE E E E 8E u xE  PSVPh]Sƃ E4PE0PVS/EP9u E P Ph]SAƃ0E4PE0PVS=u ǖE PPh]Sƃ0E4PE0PVSu fE Ph]Sƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhBDž vDžr19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0PjhkE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhWƃ E4PE0PVWGC9| Ph(]SeƃE4PE0PVSa9E DžU4E0U]h2SË+} ~19}!E Ph5SÃF9|PR+PP?YRPjhޙRPRj0+@P ]h;S#19}[CE u7vRlvN4%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWS1u )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjh̚;] s\3D3;E wPFPhΚ2tURWjhҚ|`vƃu1l>#tǃhќViÃthԜVOÃtChBVj~UvhBVjȂQ t$hBhBځ vBBB=B==vC; t; t===ƃhԜSqÃtACt;;t6; t.; t)h>shԜS6ÃtCu=e[^ÍvU WVS}j#^;tW3t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0 u~؍e[^_USt7u ul"]ÍvULWVSE DžU0CE} t% }tD}:Džv  Džw UBЉUB%DžDDž փ ;VPURPtà ҃t;{}t }u?vӁL0C)‰UDž`C`C4CDžBB@CDžDž;vVPUR,sà 9҃ލF ;VVtǃVt }uuVtvVtÃ3;3t}t }ChWVREP+rà 8W҃!;]Ӂ);PE0C} hWVREP1qà |BWrt2;n;~:vP蓰)v;}tOW>PEP1PjgPURh j%7 0{v t# svbP3tURVPURoà Aptx; u0C/CsvӁ~v)ov50C,t%50Chj% ރ>v;~.hdVSvvhVhD'|HEHE0C0CD4C`C`CBdB@CB tEPEPRu0C =wB%1u:.uB:uӀz.=wB$%v1tj:V u >:>~.hdVSuBhVhDzHEHE0C0CD4C`C`CBdB@CB=wB$%1u ::t:.uB:u΀z.0hoǃuvhWEPjV[fà }W-ShPw4EPVSWÃW2#WۚSh11e[^_ÍvUWVSuuou1}uI} uCj hV|tj h V|uE EE }t }t v/;E tv}t}t4vPFPFPFPhP pv3%P3$%Ph2P贝Kỹhh9P _vh;ƃu1>hVj jWbà }R}u4hhBW褓hVj jWAbÃ0}V跘ShJv V蛘Sh1j PSV ÃuVb1{VSECE C PhdEP5YBdB }u) t hdhdpCC ؍[^_U\WVSEM1E 9E}vЉU1;us:#9t(лvF9s#9uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉUu kt}t ÐU%øÐUVSu];s~s~Vu 3萚3)s1e[^ÉUEPu uÉUl WVS]u tShj#ك$Anu  ABjjh jR[ǃ 􍅸PsShW* PPQPhW* A tWꋅ+P=Au`At5AhW1*AtPhW*=AthW)hV@jjh jPZà uNW褽v<%u(~mu"FS􋕨RtP1_vSP_FuSj_SEƅ uVW,W+ A tT)‰Ћ)‰DžDžjPj荠=$dujA P5A jPW5A`jRW5A`}vAtmjjhžƃ|Sj>W@))‰SDžϞDžjPV諟 V[^_U=At5AA dÐUVS=Au/jjjAjjP =A= dEjEjhhҞu]SpjjV5Ad % duPjhhߞSepjjV5A, % du5AAx[^ÍvUEUtAE Atu AAt$dÍvU5A|AA dUU$At$AÐU WVS]u EFt7ЍxCu1:EuWVSuK؍e[^_ÉUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRmƃN44GvRmN49u Cu1QvRmÃN4Wv RVm N4)É؍e[^_ÍvU WVS}]E EvvRmƃN44E@EvRlvN49tWvRlà N4EPv R{lN4)ÉCtO>1e[^_$FreeBSD$SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD$SD$L$ 8t@u1[ÍvUVSuU ]u CFl vCB3hs] sOSFNpe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPkt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKjFÃu JltPE0Cu3-7Cu$j3؋ S̋PjiCUCS PsEpL 7swLFlC^lFpe[^_ÉU WVS]} uSM[ltOv3Wiu;CuPsvxm[utC UCBv1e[^_ÉUEtt.tt *12)H!`Phh@dю@dÉUWVSDžDžDžj/uuEǃ=0AtB9=0At:5t&~`t VAVރu=0A} t E }t}u 56tFPu׫uu4jt薈ƃjtVF\FhDžPPv\論tu f;FdtM~\W Ã~`tF`PPBЃFhF`WSДSw ~hG~`t F`PPBF`F\juhhhS jSÃjSW8#DžDž jPS!Nj9tSkVhjFHPFIFHFLfFJfFXS"(SFh@,~`t F`PPBF`F\jS8ƅDžjjPjhSà u:=`=` =h=h)f=v{CS@g,A,ADžKRPPht URh jSЉǃ tFCS@Fh uh5\Q,tKCS@Fh,A,ABPRedCS@ЃjFHPFIfFJFLfFX FhjAuFP~`1,A,ADžF\h hF\PRPjhFHPvF` uh'Fhjjv\uh"JDžSzSv\ƅ PSv\諑ufFd/vF`PPBЃt V $t 5} tU 21h[^_ÉUWVSuE~`tuEPEPv\ t}u Ef;Fdt8^\SpǃF`PPBЃ SWNW F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1tHCPWu,St S ދue[^_UEU@PMU2PuBMM1EPEPt v,AUEj ]SnE@`HE؋URPSh\ EPhT jEp`ЉÃ0t)h1Ep` #uC cvu ÃuOEU@PMU2PuAMM EPEPuuEPh\ {؍e[^_ÉUS]=euhhe^t e1]ÍvUMMEU$ @P |M U$2Pu=M M$ EPh x؍e[^_ÍvU,WVS}t(}t} t} u @vEPMQt v,A1EUBHEBLEBPEBTEfEjjEPjhEPǃ uhlSA EEUM JMAOVSEPhL2 Rh jWЃ t5hEp`vGW@Ѓ uGW@Ћ}܃EPhL2 v u1 We[^_ÍvU,WVSut't} t} u vEPVWt ,AUEu]E CjEPE@`HEURPEPh< Sh j Ep`ЉÃ0 u\t(hEp`1uj Nu ÃuUEEPh< Gu؍e[^_ÐU,WVSut't} t} u vEPV't ,AUEu]E CjEPrE@`HEURPEPh Sh j Ep`ЉÃ0t)hEp`uG [vuÃuuY‹EEPh t؍e[^_UWVS}t}u EPu t ,A1jEPn E@`PVSEPhX EPh j Ep`Љ0t(hEp` uF ruuUE ȍe[^_ÐUE$v*Ԡ@y_qriaYQ"I@A^9x1)ڢ!Phhdi{dÉUEwtBw t4t+mt_tR`t;w t6.& ÐUS]=euEPutehe't1he']ÐUU hBPRu xt 1U,WVSjEP EEUREP\u!URh pE 1*}u"URh pE vUUtvE@P[tǃuWuJ6E8 E@P3tÃuSu"6E EPh ;p5uSuWURЉƋUE 0WtSt 8vEPh oU EPh oEU e[^_ÉULWVS} ]$1=fuEfj LsEt"DlP)sƃu4h5\Q9 ` 订hvDhFXjEP'Ufzu(jEPU REP7fgUfBE@8ApUFBF BFB FFEUFV F$F(~T^\F`Fd9f3f3E3ẺEEEE E܋UUjWvX^8SeEPSh FB<6t*B<"EEPQ2>p}1ÐUVSu^{t 3BlSPztCLPBЃSbVbe[^ÉUWVS}u 1nvEB=~=Z S=aƃu 1SjVeuhVjxPCmMAQ PT`} PTptpPjjV@PSmH -LjhPlhx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t V`}G$/8E9t Vf`E@$LP(SMQu }7iEtu-G(6G$E軎UB(B$E([^_ÉU WVS} u~=VWE0iiÃujUB(B$v)߅ċEe[^_ÐU=fuht^ffUWVSuEÅu 1vVEPVBЃu.Pu hhS߰Ѝ\@}E$vu>Ph+U)PSȱ{uƃhɤSb߰Ѝ\ tVhҤvuhvuuhSbuuhS{bEƀ ƀEe[^_ÍvUu uPhҤ5\Q(ÉUEv  dÍvUuPhҤ5\QÐUVSuÅu 1v` tuM5dx5h/=P5`TPVhhS?$5`+PVhŧhSƃ ƃ؍e[^ÉUu4PhҤ5\QÐUEv1ЧÍvUu uÉUWVSu uMDž|u|PVEPi^|jEP_v^u+DžlDžhDžpDž|Et變.%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPhà jpPhPlPEPfà |||VEPfÃfu]Ӊ8t)jtPhPlPEPrf E9t"|PVEP1h}}8؍H[^_ÉU VS fu$j@jVÃu 1 f{<ux K PS@C SCC hAujjC(PVRLSV$N C PVNFV@ЉC:u~/t>/tj.Vt1u Ĩ>:uF>/ЉDžӨװ҉PSehS f VSej.V7 t DžtjVeuDjVÃEPSc|E%f=tS aqvhPSaƃS` u̍RQ} Se} PQG RM L􋽄WWC FE ;0|1U ;r}DM LtB Cz v B F} ;w|1E ;p}FM LtBCzv BF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu`)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS2)]C}tMQ}WS)E1e[^_US]Sh4tjSh]U=|5h fjth f@ÉUWShsKÃu =~Shk߰H=%tShV;u= f$flmtmhhlV?h fSt,;:tjh fSth f2e[_ÍvU WVSE}E f~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CLAG(e[^_UVS]u 5VjS=e[^US]hjS]ÍvUVSu ]=uhJShVut C(A vC(Le[^ÉUhjuÐUS] Sjuh؋]ÐUhu uGU,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9Eu`M; }ǔu~NF;|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr06MA0E` ߋ})tPw]u(U9zr :)z=QMQEP u$URE URPUrMуu"u=Qt EPpSUz0t"Ѓ@9B0tr0R5MA0UBBb ߃=Qt R@p1x[^_ÍvU WSE] EǰHEUBUE=Qt SoEPSYǃ=Qt Soe[_ÐUVSu] =Qt SoKyC;C|< tSV+ƃ=Qt SSoe[^ÉUVSEPu \ƃt+Åt huu} fC 1D7;Es5^SURW..]߃B;}v!}t MX(+E e[^_ÍvUShPuu uAà t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1W([^UEރ:w$v1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =tl~UBU9t.UPBUuǃPFf 9uWKuԋE8u@>u E+E _vU:u(2؃? Ћu WV(*vFTEE9E0+Ve[^_US] jEPuM1C@ ~CCjSEP']ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÍvUEM UttRQ"RQU/ÉUWVS}EEuEeShԪfƒt1ԪB=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:u @E8:yUUEE2EvVߪWiuVWSt e) E܁}Ey:uG}}}u}]XC;EECE܈CEE-.s;uSUR&*}7G}*}tC;EvnECE܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÉU WVS߾fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1RjEPSQ8"tM9]tHE4]tM<.u t0GC6v R N4%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USMN< @ }'B+v1;}; | ;J~@;|[ÉUS]jEP-} tEE]ÍvUME EUBEjjEPQjRDt1vÐ+v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÍvU,WVSu]E}ٿ K<)Ȋ8хu}K-EPh+E P EPSE PWe[^_ÍvUSEU ]~;8w|SRPa#S4lR9s1v"]ÉUS]~;8w} l!Nj$hS]ÍvU WVSuӃSǃtSVW#v1e[^_ÉUWVSuEFӁvR! N4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uE1uEU1EÉ©=wB%1tnӁvRLvN4%ۉځvSvN4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}L" }t߃} tE}tFU e[^_Ív$FreeBSD$WV|$ t$1L$u L$t@^_ÐUu ut1Uu ut1Uj@u ub t v1Uj@u u: t v1Uj@u u t v1UE hPPut 1UE hPPuqt 1UVSu] SVtACPV,t-CPVtC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPVt1e[^ÍvUVSu] SVttuCPVu1e[^UVSu] SV,tCPVt1e[^ÍvUVSu] SVth jCPVt1e[^ÍvUVSu] SV`th jCPVt1e[^ÍvUu ut1UVSu] SV4tCPVt1e[^ÍvUu ult1UVSu] jSVZtjCPVDt1e[^ÍvUVSu] SV|t.tu"CPVdCPVou1ve[^UVSu] SV,t-CPV,tC PVt1e[^ÍvUu uHt1Uu u$t1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjVËU uhT5\Q躪1;VjS$jSWU҉ƃ?uSZE e[^_ÍvUVSu] ;%EEPVu1#}tuuSVve[^ÉU WVSu }jDÃt6VƉsu_SVQtNCPVe t:CPV)t&C PVtCPVv1e[^ÍvUUE w:$v8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSWuLC);S|Su+1KB;St C t uSte[^ÍvUSE] MUtt!RQS) vRQSmv6/1]ÉUVSUu ]BPBPBPPhSVZ 9s;61e[^UlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE PJ߰Ѝ\*EU4hS ÃE}?}tEEu:CCUЉ);EwRM Q-E C41e[^_ÍvUWVS} u]tVtACtJuutAu)H[^_ÍvUWVSu} EPt 9tAs)։)u$߰ЍDtAJC;u)[^_ÐU(UE EPEPÐUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSE] UURPt E1]ÐUSE] UURPt E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFShV@F>u/FRQV@ Ѓtt"FShXBV@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VËE uh˫5\Q貒(VSWvtSgE 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RCËE uh5\QN4EuSV\ SE v1e[^_ÉUju u UhEU fEfEEEEEEPREP賓‹EÍvUE@( @,, NN1ÐUEU} utN@0 tH ÉUM U}ttEtA vtÍvU=N‹,B0B4B 8B<B@BDBHB IB$JB(KB,LB0MB4NB8ON=Nt(‹ B$B(N ÐUSh`jjh5phluà t Nu5h_h؋]ÍvU=lt`Uj juuUShjjh\5huà t N55t¡ 5Z¡5C¡ 5)¡5¡ 5¡5¡ 5¡؋]ÍvU =tUlWVSutuuE M}t*EPEPuE }փ5ShS| EPSlhS^ uSOjSph PP\u w%O8Pǃu% EPWG>4PSPN ;;~ u!VSƃ;u|uv;u}%Ovu􋅜P}t EP!19}߰ËE B9|;U}E B;U|E 1?v$Wo$e$􋅜P0O$[^_ÐUVSEu 19sj Pf@C9r؍e[^UVSut>u >v:;:-uz1uCBr=wB%1t B=wB%1tB  u9tvCB:i[^v̀rÐUWVSuEFӁvR N4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=wB%1tnӁvRvN4%ۉځvSvN4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tGc!" v}t߃} tE}tFU e[^_Ív$FreeBSD$L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuX$FreeBSD$W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_ÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEPD$E%f=@tvjURZDžEPS E%f=@t!njjPM<Mj ;2it DžU tFPSx1t t 1ZDž1Dž1IRPШc)؋NjPSWRƃ~)눉M ] tV􋅘PjURY u+􋅌P􋕜RC Džv1;sDu:ft3WG)É9׃9t˃t F뵐hjVRDž1;t_tPCP t {u E tF<u􋝈S$vPP+x x-CPDC tBCe BE BR B3􋅜P􋕘R_ {1h[^_U=u5EUBEjjEPhjRtÐUVS]sS 3Cs ? S S* Ve[^ÍvULWVS}w`} TEEuUЉUE EPEԃu EEЃUREPU REPURE EEԉEEE EEЉE؃$EċUԉỦ׋E9FvẼ$E̋U؉U+EEЉE܉EE9Et Ẽ$E̋E+EEЉE؋U9UY9EvEPURU҃EEuU܉UEEEuU؉UE}uC E}t/u;uVEPU҃;E]yvEEE;SURU҃;E]E9EEދU҉UE0;]r]+]9vSURU҃;E~ދU29EvqvE)1uE0SEPU҃;E]vދU29Ew/}U2SEPU҃;E]ދE9EwҋuUUE9EuY}t/vUU9rUUEuyUBUG9rUBUGMuV}t.UU9rUUEu!UBUG9rUBUGMuE9Es U9UE9Es;}tUUE9rZvUBUGE9rBvU9Us7}tUUE9rvUBUGE9rE؋Uĉ$EċU9U}ЋEԉEЉ}ԋE EEȉ$U9oE9Eu!E EPUREPnUЉUԃEP1e[^_UWVSEE}w1URMQEPURE $UUU v]MQEPSU)ډ]S]+EM D$UUʉMuU2PVMу ЉU;u{M<1 v};}s"U:PWMу%;EtӃJUM1+EE E}~E0F BKu+uu9rv}U<2;}seW+]SMу%;Et:U+EE E}~ڐ]F BKu+U9r};}r}~ +U]F BKu+U9r;urV+EPU҃~U+EUEEE Eu;ue[^_ÍvUWVSEEEU JUtG}vuvCANu+};}v+]WSU҃͋EEMue[^_É$FreeBSD$D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS]u EUM;tuQRPVSXvt {u5t:w t4jhPj"t:wv qu1fSwI$c ,  e[^ÐUu uhÉU WVS}jÅt85sGCGC { e[^_ÍvU WVSuU Ѓ  vߋt]9SutTC ;FuC;Ft7jCRP6CFFF;C }VwuS7e[^_ÍvU WVS}1  t!9zuRӋ݉F~e[^_ÉUVS]C;C| CuUC{u!CuCPss 3VC~'CK ufytASJs)։9~1AC9tyuCuȍe[^ÍvU WVS]} 0S>8tu=0t%C$PSWt E8 vE1e[^_ÐU WVS}=u EPu &ƃt5jjWh,Ã|ڃtE9t1?7tfp Et uH fx@@$0@,p@(@ e[^_ÐUE URPjujhUS]SEt K]ÐUUB f t1 RcÐUS]=uCC C uMC u vC t&S c CCK 6{0t.C@9C0ts0C0Ct36q)KC =~;_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P(SDAK C$jP @PSD t QVS0S(uC,K@C<Й{@PG(;C~CPS e[^ÉU WVS}E4jW|-t EtN04uуWt}u aE1;}*8<0t40C;|܃tWU}u1Ue[^_ÐUSE} t?tX4t+jjS7,uӃSuǃ01]ÉU WVS}4aGj h  ЉG@SW0 jjjVut6hSVt=t"O,Bv1ۍ8<2t"jjXP42W  uC~1[^_ÉUSEX}uuu jS Sǃ,]ÐUSEUXt$tǃ,Gvuǃ,vuu uPSl]ÍvUSEX}vǃ,/tju jS"kǃ,]ÐU,WVSEp URUM MjjRQPmPEPD&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR%EX MEEp f{URMQEPURMQiE EEEPUR$fju%PMQ%E~XEEUr E9E} w/} r)URMQEPUR E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEPUDSMAMECDK)‹MQEPURMQuEPURMQEPtXUbSMQEPUR|t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t dž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV"ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÍvUWVSu1Lhhxt#x=x~ttth Džt|uDž|2}uED3}uNLECDž|2DžlDžhLUDžtED3Džx}t }h$藽à 1ǃEǃ|Eǃj$8Ɖso1 󫋅L9t ^F F F F FF\(F0 }tWE  tt uU RMQ.-vE  jj0oEPRE EjEP'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjKI uSh h 3IStRM t!@E@t!}}"[vvoOt7{ts褹tS~18[^_ÐU WVS}jj7Iƃt jV8EP7Hƃt|EP7HÃte}u_CCfCfCC jV^jV7K jS7J1e[^_ÍvU0VS1nuh,QÃ؅u3Ph8hVB ]SV EPSjV à t VjEPjq؍[^ÐUtt  1USEX{tjs3IC u v#]ÍvU WVSEX{tjs3IC}t}EPu Sp<ƃu[}uj63@I@jPujjVS>ǃ !@tj63ICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u/CEUUEEU܉U}ؐ֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u1CEUUMMEE}vƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6lAFjW6YA~tvȮF Ft%蠮dždžt%rdždžVLWC S÷1҅tЍe[^_ÉUSEX{tjs3Z@C} tC t11 tS"t3l@u ]U VSujj6=ÃtZEb1EEEE %EjEPSD;jS6{?1ve[^Uv\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEPD…tEЋ]ÍvUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}twp;tC;u+]K9r2%))Š`K9r;XtˍSU} u }tMvK9vC;/uEPV膵/E%f=@t} t.hh VU }*8tQ}thV蜵uָlEPVߴtK8%D];t79t3Ph`t@8u 0CӍvCv1e[^_ÉUWVS}jEPsEjjh2à |jtEPS観SuE|Džxw 0_ˈwxw|GG02G 0xx~X[^_U=u+1v@=~hÍvUWVS}u =u 1ۍvȈEؙE:C~[^_ÉUS=u       É[ÍvUM19s v@9rÍvUVSu1ۋM Itۍ1Fs%Э))É[^ÍvUSM] 1iGuWEP"jWE0 (vESG9`SG9u.%CPWE PEPƃtsf{uECfKftSE PEP#tGtIjWE0}'}p1EjWE0\'.jWE0H'WEP,e[^_ÍvU WVSVj6E0%ÃvfuESB<GtG PUR!ƃDCu^;u!fCUfCC SEPSURc"v7 C؃)RPP!fsUCuWEPEPEPQ]SWWEPEPEPVEP ƅEBFf9Es'%U)PЍDFPЍDFPfFEUԋB tdw tbMVF)fFfJEB0WMQS2UԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMAq ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBC臌v}M 9u9] }uuQS]vuuE PURt}jMQ]3njEP3^ E,U9tv1ۅjuM1ju]3 1ejEPU2jMQ]3 juE0juU2 Mq*e[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u$KfFEfU]3E菆ǃujVU21v] GCGfGUfGC G {t?js2ÃuW1pCjSU2Wu]SVWE PURà EWU R9u] W豆U EE0؍e[^_ÉUWVS}EPWƃtEPW Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G t G WwFCfCfCC4E@ tBEP4UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQuKiEP‹ F)fFfFF0QRSSUC ;vfFf N jVM1b1e[^_UuPQvv36wF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u PuC@PE0&wuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÍvUWVS} ]ujWEPjGPEPE U;Es;>uugsu64u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU28E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0c U)]jSM1=1e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rу_^ʃON_^ÍvUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÉUlWVS} uEPW\|uE%f=tv1lh(jeÃt[1ҐDDD B~E 1RPEЋURP貒؉e[^_USEU M] $[ÍvUS]uh`5\Q& sS u1YQE AAHTt HJ QACA CACA]ÍvU WVSU E;r1vE PURÃCHUL;t CBCACtXYK{tSC B vC UBS CCUBC BCBKvURÃ1E U1jWVx99EswU;tלOE CCE HULtXYKCUBC BCBtss$АCe[^_ÐUE U`P1ÐUS];t4 yt QA B A CQ AQQm;u̓S@m1]ÐUVSut"vCtSVt"[u1҅tЍe[^ÍvUVSu; rrtlCu^CtSVtyCHT;tvCBS{t SC B C FS C4[uPCkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVS2v9u39u/E pIu;u U b1e[^_ÍvUU BE9Ptu1Ðuv_̀rÐUVSu uV0jÃt VS؍e[^$FreeBSD$WS|$ L$1~ڃ)Ӊك[_ÉUEPu uÉUS] {tSu<'CC C1]ÉUlWVS}M UG $fEGfEGEċG,EԍEEEEERQuVBÃ|VpTtE@tO @؍[^_UVSMEU] t txv w K0 }K%)щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu +lv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VSQ(0v(Ojj VS4(0jj VSN(É֍vOjj VSȈ0jj VS莊É։ uOvO$0 u}t0?0t+O0%O؃ u jve[^_ÉULWVSlDž =QtEP訢UB tzu2MQNNt=Qt EP膢UB f uDfz|==Qt RSMQE PUR_DžM Dž$DžEuuEEDž t%%t  t%u⋝+tLS^]E}~EPMQ u DžDžDžDžƅ  X$خuƅ 뵍v1ۋƒЃ w\BBЃ v⋅8$$u)0$$PQE Pr$t$EURAEv$t#$BvEMIvƅ+v *1ۋƒЃ w!v\BBЃ v⋅8$uw$u)0$$PQE P$t$ vEUZA5$t$BEMYWDžH1ۋ & \BЋ ȃЃ vԉDž1ۉ \BЋ ȃЃ vԃ$uC$0$$PRM QltR@Ft /" P$t$AEMA  tw$t*$H!EUBRt $uIj@t2$t$/EMI=$t#$BvEMI} ƅ- u u Džu Džt<$t$(ݝ:E MiݝB$t#$ݝBvEE@ݝt+ܝEuƅ-Džv xtDžF  t 6_Dž  PP RPPQP,0 gt Gu?~9~E gue vDž g eA QEPvV fu;~&u tW|9K@;|Njt%"+ Gƅ- tI$t$AEUBHtE$t$BEMA?v@tE$t$BEMAf$t$AEUBv t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ $t#$BvEMIDž߀Dž x$t#$BvEMIu Dž|>PjRt+;Ѝx tZ$t-$HEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ DžĮ Dž t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@t& t t tƅ|M tK u twQPRPQR=vu t1QPRPRn +x1  P Pƅ9}tt9}+~ENFEE}~EPMQ uN^]E}~EPEP]utFEEtcƅ0 ff FEE}~EPMQVu%=+~~~CNFEE}~EPEPkuN^]E}~EPUR-u)~ENFEE}~EPMQ`uN^]E}~EPEP"uu~} eG݅D@ծFEE}~EPEPu;|FEE}~EPEPKuKH~CNFEE}~EPURwuN^]ծFEE}~EPEPuFEE}~EPMQ`uۅ~~~CNFEE}~EPEPuN^]E}~EPURQuFE;FEE}~EPMQau)Å~FvNFEE}~EPEPuN^]E}~EPUREuFEE}EPURFEE}~EPEPCuFEE}~EPEPvu)N)‰EE}EPMQ-BBFEE}~EPEP;u݅E@t@JVEHEE}EPMQK~CNFEE}~EPEPuN^]E}~IEPUR)FEE}~EPEP/uUNME}~EPEPou+~u~DNFEE}~EPMQuN^]E}~EPEPu]}tEPMQu4Eu}tEPEP~uE t LUB @t Dž=QtMQ$t09$t$K[^_ÐU,WVSEEUUEEE@M EE/%u"E1MAMBX$<1ҋu TPFЃ v>$];]|EPEPS;]~]E]jvE@E*1҉vTPFЃ v>$u9];]|EPEPS*;]~]E]Fu;]|EPEPS;]~]ECBЃ MAMBЃ v1ɉLBЋE@EBЃ v$v@t sk t1;]|EPEPS?;]~]E Cvt0;]|EPEPS;]~]EC@t0;]|EPEPS;]~]EC;]|EPEPS;]~]ECft0;]|EPEPSf;]~]EC.;]|EPEPS6;]~]E C t0;]|EPEPS;]~]E Ct0;]|EPEPS;]~]E C@t0;]|EPEPS;]~]ECV;]|EPEPS^;]~]EC& @;]|EPEPS;]~]EC;]|EPEPS;]~]EC t0;]|EPEPS;]~]E Cbt0;]|EPEPSb;]~]EC*@t0;]|EPEPS*;]~]EC;]|EPEPS;]~]EC}~UPEMU;M~Ewj$UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et u[Ee[^_ÍvU WVSE EE84?E@9}ƃu,VDÃu%HWSEPVEPSÃuG)PjPuHE E0e[^_ÍvUWVS]}u fu etEuCu(EPEPWSRu uc}‹EgtGuEtN fu90uEE@t@ED@uU vE0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuW)U  MrUG t^EEUrUtvPMQwG,ЉÃl])ދU B)؉BuPG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t&9s~SEP79F)_v;Gv-9v)SURPFWP, Dv_9r!SMQwG,ЉÃXSEP7E)_])ދU B)؉BEEu EM MEpEt}u3Vj URƒtEH)‰U vNMEU9vG_Ë;Gv'9~#SURPEWB+ uw>_9|SMQwG,ЉÃ~TӃSEP7D)_)]uW*u"E])ދU B)؉B1 O @e[^_ÍvUEPEURPEU RP+EUÉUjEURPEU RP+ÉUU1Bf%=uBu}tUE1ҋ@%=u }ЉÍvUVSuu V%@Ãu t Vo?؍e[^É$FreeBSD$W|$D$ L$uG_Ð1_É$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rу_^ʃON_^ÐUVSuP=pX@@ e[^ÐUug>ÐU WVSuFE^1M ME ЉUȉG;}|ɅtOM;N|7F@PDËFK V PRQB V\ލFMU BVe[^_U WVS]} M98)1Ҹ~ vB9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt't1`t NB1fuuuuu @u US]jdX@]ÐU}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPEURPà UR2]])t#SuVvEPURU WVS]=t S5`װHPRjװHPRj\ HPVj<߰HPSje[^_ÍvUVS]jw S u/ +hPl;trRu1ve[^ÍvU WVSu p=tjjjhj Pjoà t=tP5pS 5tppWP1e[^_ÉU\WVSE}u6<j?}Wh;>"}uhŲÃO;F> $ QQv-QQQznbVJ>2&5h5CE}>=t&EEEj EP=t =t jjjhjhjp uh?j ht=Qu Q%Q jY`e[^_ÉU WVSE]1 xv t29Yruy9tABQMvyA)Y uSǃtW +5hp9sv1pA9r=t PhW }t"=u EvEPXe[^_ÉUWVSEwEHEupU<shENMEU9~.}WÃuEP1v]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +hppMu 1vp}K{u9t1u Ft1fK up}A)K =tCPhCP Ce[^_UVSu=tc v9s1$w V VsÃ=tt VjS ؍e[^U WVS}=t +h wh  v;lvh`vp;u[th;t=9u 9E ;v{@Ht hn%J MƃM#t h2p=u-9u s(9E wuxhҴ1KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS}<=`uh !=M + h wh ; lvh`pEuhvthҴnEthQkppƒ|u1A1p<t =tVhUR=QtjVMQ_}=uj|UPx p=xu@xxv}xM9K s;tE9C s;u9{vSPCPjU9S u<S KK;tw;PugE@ C EHKUtSXE9{u sMK4;uXh;C;QvuC ;ujj 9uUQS‰S CR C s +5hFl9wpA; lv}@UR/}K CHEthMSM#th=tCPhEPa DfC S pf{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +hps9t SVe[^_ÐU VSu=QthQ@d=dt/hN d=Qt Q1=`u=t u1VÃ=tEu]j EP  d=Qt Q=tu h^<؍e[^ÍvUS]=QthQmd=dthN5SS=t]EEj EP d=Qt Q]ÉUWVS]} E=QthQHyd=dt0hN d=Qt Q1vt=`u h 1ۃ=`uO=tuSM1,u W' WSƃЉU=t]}uj EP  d=Qt Q=t}t h^Je[^_UWVSEE}tu=uj+UX]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=ul+E X]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÍvU$S=tЃ]SjS jSj2j P jjjSj jm Pc j%$FreeBSD$WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rу_^ʃON_^Ív$FreeBSD$D$9Qv QD$̀rD$QUEU RPjuuuu ujhUS]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCP$fc uu CPD]ÍvUS]uE URPCPuu fc vK CPST]ÐUE@PU WVSEHQt1v_wNxvf{ tSU EXNy?uҋEe[^_ÍvUu ht,@uÐUDž=Q|A=Qt*At@9Q=Q|b @QjjPQ}60h(5\Q#R5QV};ZG0h35\QqvQPE PEEEEE EjEP5Q6‹E  9t70h>5\Q(ufDžPV5QqÃ~)ffuɅ]D40hK5\Q 6Dži MQU9~8thW5XQ0}DžMfvff wAtPhn5XQ|Dž(u vf)ft PV5QÃͅ!0hkt^J+Mfft?fwSP5QÃ~ f)uf;1u  h5XQ{5XQ;E~EPEP v=Q|=Qu@9Qtv=QtR@QjjPQ}60h5\QwQ=t=QuWQ5Q}+ 0h5\Q6Qju u5Q迲;E 0h5\Q1v=QtIƅDžfDžjP5QNQOQju u5Q[ ;E t+0h÷5\Q:~ = DžBR)ЍjPBz?B~B=Q}jhʷQfBfBBB BPjPjPR6à 8jPP;u;|{v;}j)B)ȉB}B@Bv)Ѝ 0hڷu0th5XQ\wDžDžPPjEPUR5Qa (|0h5\QV=Dž =thn5XQvDž(f;t$u  hu_P4uIu  [h5XQv5XQ;E~EPURqusEEPMQE EPuquRu  h5XQu5XQ;E~EPEP Bt tu[t7h05XQ4u5XQ;E~EPMQ; =Y u@Bt4thH5XQtDžu%!=!uh]5XQtu  t7hm5XQWt5XQ;E~EPMQ^ ttu u=QtK11ېPEPURu uQЃ $C)xt􋅤P;t; @c􋅤Pu(u = <v [^_ÍvU=Q|65QGQQQQÐU|WVSEEuBEEPE0OjjEЋURPǃPEv}tVU҃F$PÃFCFfCFCC@PCPFP螝9}r!(PEP"tgE UEBUURƃGEP}t}tURjEPURE UEBSMEU4}uEPURgx[^_ÍvUUE PPÉUWVS}]}t$uE PEPL|1tVJEGEEEGEEEG ESEPhjwSjhjj4ƃ ^t(t!GGƃ }u ! v|}- jjj|Puiud 8uZE ;! h|Px @!tTME t t! EP|PBE Es!FFF F tFFFjj3iƒtcB ub J jjR3kt$t! ujSЃtCt V)}t|P]y1h[^_ÉUSEX{tjs3jC!u v#]ÍvU WVSEX{tjs3jCEHwq$U 0t]svC(ts$Fd]C(ts$NuP! ujSЃcvt;vB\N)Ãr2PWGfFEf+Xp0PWGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEPVU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVfEH8U J1e[^_U}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ<;E u\f+EtHf|sDsU)‰PDsEPEPUfsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEP& E܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuURw;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVLMIuf~v6EEMAUBETF9UwQMQV E@<\tPU\@jؙ]K t1RPEP|ut/URV]Stt;EtOf}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR[G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1hjBaEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVe[^_ÉU0VSu]SEPSj hR t"hRjj jEPj1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1PFEf+pf4{p0PFMf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms 8M tMjjjU PP847S u78M 4贷1e[^_ÉU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEPPE)]]7FEfwFf7uM)fLWUfTGfwM QEPBE [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEPD])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEPC)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPWÃt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]SiE tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPS t)Afxuۃtfuǃ $jU RDFPS  @f8uL$ǃ :jE PDFPS ƒtUEPEEPRSǃ~:EU 9B u#EPFBPEP=/e[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtծSɭUREPjU RW t:sjE PDFPWc tWURURSPWAà ~;EU 9B u$EPFBPEPN<e[^_UWVS]jEPEPuEP u`uuUR;EЉUEPEPU fB ft,juB PEPyU BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR$C!F;;s1glv69V)PPRXEE EFE} wcE$ C(tRs$eU 0uYEKvU 0t%;vU 0t;w1;v#v;! uVSЃ@9!t:踩EtEPPu9EE@9v(}jWS}=@9w!tu7EPEPFPS>u/}t } tFs$!jU RVjSe[^_U,WVS}UM9AvFEPQR5UUMAEE]CBEMEU E;w tu vPM Q]Su .ptItEU E;s7PSMQǃujS]3C;FExCS)ЍW9s2PWURMQjS]SvCf9s)RDCPPz6fC΍SC)fCfJC؋MQU@q1P96M jS1`:1e[^_ÉUSR=RtvЃ;u[ÐU;fixit_crunch%s: %s not compiled in usage: %s ..., where is one of: %sgrepedtelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.8 2002/06/29 05:09:26 tjr Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdout 8DPh-stdin%sr%6d buffercat@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.6 2002/10/18 01:36:38 trhodes Exp $HLPRXfghorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_readlllllllllllllllllllll8lllllllllllll 8,llllll8ll8888`88^^^^(^^(^TTusage: chmod [-fhv] [-R [-H | -L | -P]] mode file ... @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chroot/chroot.c,v 1.4.2.1 2002/03/15 22:54:59 mikeh Exp $.%sSHELL/bin/sh-iusage: chroot newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24.2.7 2002/09/24 12:41:04 mckay Exp $HLPRfinprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sԒԒԒԒԒԒ Ԓ@ԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒԒPԒԒpԒԒԒԒԒԒԒԒԒȒ%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_read$FreeBSD: src/bin/cp/utils.c,v 1.27.2.6 2002/08/10 13:20:19 johan Exp $%s%s not overwritten (y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.2 2001/01/23 14:20:03 asmodai Exp $tȥ̧l@@|yso$l| f@@a@@\skipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %d* $       unblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %s H 4x%s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.3 2001/08/01 01:37:35 obrien Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18.2.1 2001/08/01 01:40:03 obrien Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.2 2001/01/23 14:23:55 asmodai Exp $%siseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.9 2002/07/01 00:14:24 iedowse Exp $ufsabgHhiklmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.BLOCKSIZE=1monly one -t option may be specified%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed (Lht?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifreeiused %*s %*s %%iused Mounted on %-*s %*ld %*ld %*ld %5.0f%% %*ld %*ld %4.0f%% %s Y@ df: %lld: %s usage: df [-b | -H | -h | -k | -m | -P] [-ailn] [-t type] [file | filesystem ...] sysctl failedmalloc failed$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8.2.1 2001/08/01 02:33:32 obrien Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28 2000/01/17 02:04:06 bde Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%lld|&=<>+-*/%:()%lld %s syntax errornon-numeric argumentdivision by zero%syacc stack overflow 0H`x@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. -lillegal signal number: %s%s -soption requires an argument -- s0--illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. linkfhinsv.%s                                                  %s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fhinsv] file ... directoryusage: ln [-fhinsv] file1 file2%s %s %s @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. COLUMNS1ABCFGHLPRTWabcdfghiklmnopqrstuwxCLICOLORCLICOLOR_FORCEColor support not compiled in. 8\$H@dp| 0@\ht%s: directory causes a cycle%s: %s:fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %llu : %lu %u-%lu%qu<FPZaho}%stotal %lu %*lu %*lld %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*lld , %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s/%s ls: %s: %s -> 0B%*s BKMGTPE%*lld%c ?@PLusage: ls [-ABCFHLPRTWabcdfghiklnoqrstu1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19.2.2 2001/08/01 04:42:37 obrien Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.5 2002/08/19 00:26:41 johan Exp $finv%s: destination pathname too long%s%s not overwritten (y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times---PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i | -n] [-v] source ... directoryusage: mv [-f | -i | -n] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. unlinkdfiPRrvWp&&|&&&&&&&&&&&&&&&&&&4&&@&&&X&&&&&&&&&|&&&&&%s: %s%s %sfts_read8((('(('(('%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.2 2001/08/01 05:16:47 obrien Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9.2.1 2001/08/01 05:23:25 obrien Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9.2.2 2001/08/01 05:43:30 obrien Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.3 2002/08/07 21:24:33 schweikh Exp $HLPRfhvthe -R and -h options may not be specified togetherseparation of user and group with a period is deprecated%s: %s%s fts_read666666666666666666666666666666666666666666666666666666668888X8888888888groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.15 2003/01/24 16:18:16 des Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:enrs:w/dev/%s%s%c%s%s%sioctl DIOCWLABELr0@0@0@`?0@0@0@0@0@0@0@0@0@0@0@?0@0@0@?0@0@0@0@?0@0@0@0@0@0@0@0@0@0@l?0@0@?0@0@0@0@0@0@0@0@?0@0@0@ @|?0@0@0@@DA(BdBBCDDDauto%s: unknown disk type/boot%s/%swrite to disk label supressed - label was as follows:ioctl DIOCSDINFOwriteioctl DIOCWDINFO%s: no disk label on disk;add "-r" to install initial label %s: label magic number or checksum is wrong!(disklabel or kernel is out of date?) %s: open partition would move or shrink%s: '%c' partition must start at beginning of diskbad pack magic number (label is damaged, or pack is unlabeled)ioctl DIOCGDINFO%s/boot1%s/boot2%s too largebootstrap doesn't leave room for disk label# %s: type: %s type: %u disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %lu %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # (Cyl. %4lu- %lu) wcan't create %scan't reopen %s for readingre-edit the label? [y]: you have too many processesforkEDITOR/usr/bin/viline %d: syntax error typeWarning, unknown disk typeline %d:%s %lu flagsremoveableeccbadsectline %d: %s: bad flag drivedata%lu partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylindertracks/cylindercylinderssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: %s: Unknown disklabel field line %d: partition name out of range a-%c: %s line %d: too few numeric fields line %d: %s: bad partition size line %d: %s: bad partition offset line %d: Warning, unknown filesystem type %s sector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0super block size 0 super block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown size specifier '%c' (K/M/G are valid)partition %c not an integer number of sectorstotal percentage %lu is greater than 100 %ld sectors available to give to '*' and '%%' partitions Offset %ld for partition %c overlaps previous partition which ends at %lu Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luY@"auto" requires the usage of a canonical disk namecannot open %sboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [-n] [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [-n] [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [-n] [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] [-n] disk protofile (to edit label) disklabel -e [-r] [-n] disk (to write label with existing boot program) disklabel -w [-r] [-n] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s @(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11.2.3 2001/08/08 22:32:15 obrien Exp $_msgbufpaM:N:kern.msgbufsysctl kern.msgbufmalloc faileddmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic number%susage: dmesg [-a] [-M core] [-N system] $FreeBSD: src/sbin/pc98/fdisk/fdisk.c,v 1.1.2.3 2000/12/11 01:03:25 obrien Exp $/dev/od0/dev/da0/dev/wd0/dev/ad0MinixPCIXNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedGBCP/M or Microport SysV/ATDMVENIX 286FreeBSD/NetBSD/386BSDOPUSOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, QNX or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPC-UXXENIX /usr filesystemXENIX / filesystemMSDOSPrimary DOS with 12 bit FATunusedBab:f:istuv12345678/dev/%s%scannot open disk %scannot open any diskread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s SID %4d: %11lu %11lu 0x%02xn******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. p p p p p p p p,p,p,p,p,p,p,p,p,po,p,p,p,p,p,po,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,p,poo,p,p,po,p,po,p,p,p,p,p,p,p,p,poopp fdisk -f configfile [-itv] [disk] usage: fdisk [-Batu] [-b bootcode] [-12345678] [disk] %d: sysmid %d,(%s) start %d, size %d (%d Meg), sid %d beg: cyl %d/ sector %d/ head %d; end: cyl %d/ sector %d/ head %d system Name %.16s The data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysmidsyssidsystem namestartsizeExplicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) parameters to be used for BIOS calculations are: Do you want to change the active partition?active partitionActive partition number must be in range 1-8. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onescan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. Supply a string value for "%s" [%s] unknown@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.3 2001/08/01 08:26:23 obrien Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fsffsufsadfo:prwt:uvroonly one -t option may be specifiednorogetmntinforwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountd$<L.,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16.2.3 2001/08/01 08:27:29 obrien Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block%susage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9.2.4 2002/04/28 22:50:00 wes Exp $haltdk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confkernel="" ???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%s<DT`ltusage: %s [-dnpq] [-k kernel] vm.stats.vm.v_swappgsinv_swappgsin@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10.2.3 2001/10/02 08:30:17 cjc Exp $./restoresymtableTAPE/dev/sa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure ,Tġԡ84restore -t [-cdhkNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8.2.1 2001/01/03 14:36:08 iedowse Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help , tdج4restore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d  8%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7.2.1 2002/03/01 21:32:28 iedowse Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state <dLL|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.5 2001/10/15 13:44:45 dd Exp $Extract directories from tape TMPDIR/tmp/%s/rstdir%d-XXXXXXw%s - cannot create directory temporary fopen%s/rstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7.2.1 2001/12/19 14:54:14 tobez Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.8 2002/06/30 22:57:52 iedowse Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. %s%s%s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %ld, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d  \   \ oldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocks     unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks      Checksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8.2.2 2001/07/30 10:30:08 dd Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.2 2001/07/30 10:30:11 dd Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22.2.1 2001/12/13 01:27:15 iedowse Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%s%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%|%%|%|%|%|% %|%,%|%|%|%|%|%|%|%|%|%|%|%@%|%p%fstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove mounttab entry %s:%scalloc 220123malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2.2.1 2001/12/13 01:27:20 iedowse Exp $a/var/db/mounttab%ld %s %s rcan't open %s timehostdirmallocwcan't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%sbad mounttab %s field '%s'$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.1 2000/07/20 10:35:13 kris Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%s8>??????????????????>??????????>???????????????l>????,>>????? >?D>unknown group id: %sunknown user id: %sinvalid file mode: %s [-s] [-l] [-9] [-L locale] [-W table] bdev dirusage: mount_msdos [-o options] [-u user] [-g group] [-m mask]%s %s /usr/libdata/msdosfs/%srcan't read u2w table row %d near line %d%i%i%i%i%i%i%i%iu2w table: missing item(s) in row %d, line %dcan't read d2u table row %d near line %dd2u table: missing item(s) in row %d, line %dcan't read u2d table row %d near line %du2d table: missing item(s) in row %d, line %d$FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount_cd9660/mount_cd9660.c,v 1.15.2.3 2001/03/14 12:05:01 bp Exp $strictjolietjolietrripgensextattupdateclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotabegjo:rs:vcould not determine starting sector, using very first session using starting sector %d cd9660vfsload(cd9660)cd9660 filesystem is not available%sJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJLJJJXJJdJJJpJJJJJ|JJJJJJJJusage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ]Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundr+wwusage: %s remote-file [ local-file ] local: %sRETRremote-filesusage: %s remote-files mgetonoffand logged inConnected %sto %s. Not connected.Connected for proxy commands to %s. No proxy connection.(none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off.Nmap: (in) %s (out) %s Nmap: off.Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. (but disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Command line editing: %s. Macros: %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark).Verbose modeUse of PORT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. %ldDisabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD.XCWD %susage: %s local-directory Local directory now %s getcwd: %susage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file mlsSHELL/bin/shsh-c%sTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed.PWDPWD command not recognized, trying XPWD.XPWDLocal directory %s getcwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD.XMKD %sRMD %sRMD command not recognized, trying XRMD.XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITE %smodefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command.?Invalid command.?Invalid proxy command. Case mappingCarriage Return strippingNtrans off.Nmap off.mapoutusage: %s [mapin mapout] nmap: unbalanced brackets.Passive modeUse of EPSV/EPRT on IPv4 ftpStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP.XCUPusage: %s [restart_point] restart: Invalid offset `%s' No restart point definedRestarting at %qd for next get, put or append SYSTLimit of 16 macros have already been defined.macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line.macdef: end of file encountered.Macro not defined - 4K buffer exceeded.Restricted data portsfilenameusage: %s filename %s %qd %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmoreCan't allocate memory for $PAGER|%s?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestrictrestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgategetftpformexitepsv4editdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!...Can't allocate memory for local dircompleteCan't allocate memory for remote dir %s Must be logged in to complete.PhhhhhhhhhhhhhhhhhhhhhhhhhhhhhPhhhhhhhhhhhhhmacro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command.?Invalid command.Not connected.Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. %s: %sCan't create socketCan't bind to %sCan't connect to %sRequesting %s GET /%s HTTP/1.1 Host: %s Connection: close Requesting %s (via %s) GET %s HTTP/1.0 Failed to format HTTP requestWriting HTTP request200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file.Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s http fetch aborted.ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmget%s: %ssocketbindconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %s,<L`p|ftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %s @(#)commands.c 8.4 (Berkeley) 5/30/95%s sequence challenge /usr/bin/opiekeyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. Escape character is '%s'. status?Already connected to %s open (to) -l-a-susage: %s [-l user] [-a] [-s src_addr] host-name [port] %s: %s hostname too long for unix domain socket: %sTrying %s... sockettelnetBad source route option: %s telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. opieenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. @(#)main.c 8.3 (Berkeley) 5/30/95[host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:uxy%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. -l-sX4Z4Z4ZX4Z4Z4Z4Z4Z4Z4Z4Z4Z4Z4Z4ZXY4Z4Z4Z4Z9Z Y4ZY4Z4Z4Z4Z(Y4Z4Z4Z4Z9Z4Z4Z4Z4Z4Z4Z4Z4Z to continue...  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. $FreeBSD: src/bin/ed/main.c,v 1.14.2.4 2001/08/01 02:36:03 obrien Exp $*usage: %s [-] [-sx] [-p string] [name] p:sxcrypt unavailable ? ? interrupt? invalid filename%s %swarning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid address0000000000000000000000000\0000\0000000000000000000000000000000000invalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsinvalid destinationno previous substitutioninvalid pattern delimiterawcrypt unavailable%ld ! unknown command8<H$Lxno matchfilename too longno current filenameout of memoryshell access restrictedno previous command invalid mark charactered.hupHOME..$FreeBSD: src/bin/ed/re.c,v 1.15.2.1 2001/08/01 02:36:03 obrien Exp $%invalid pattern delimiterno previous pattern%s out of memoryunbalanced brackets ([])trailing backslash (\)$FreeBSD: src/bin/ed/sub.c,v 1.12 1999/08/27 23:14:15 peter Exp $&number out of rangeno previous substitution%s out of memoryno matchinfinite substitution loop $FreeBSD: src/bin/ed/undo.c,v 1.9 1999/08/27 23:14:15 peter Exp $@'%s out of memorynothing to undoMemory exhausted:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [7 > > > > > > > > > > > > > > > > > > > > > > > > >1 > >278304 > >p8 > >|2|2|2|2|2|2|2|2|2 > >3 >433 > >3 > > > > > > > > > > > > > > > > > > > >8 > > >l9\1 >1 >2 >`3 > > > > > > > > > > > > > > > > > > > >8 > > >t47???????????????Unbalanced (No syntax specifiedUnbalanced )TJ\JdJlJtJ|J$LXOXOXOXOXOXOXOEMXLXLXOhMOOout of memoryPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 0123456789A:B:C::EFGHIRUVX:abcd:e:f:hiLlnqrsuvwxyZzword-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanulldecompressno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s memory exhaustedrfstatlseek%s%cwriting output--Binary file %s matches (standard input)%d recursive directory loop%s: warning: %s: %s Memory exhaustedUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit -Z, --decompress decompress input before searching (HAVE_LIBZ=1) --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4d%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default@444444444444444444444444444444444444444444444444444444Ԓ D44444444c44@44444444ؓԔ4Е444844Hcd4@t44444memory exhaustedmemory exhaustedfgrepawkegrepgrepdefaultmemory exhausted^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$\\#$FreeBSD: src/lib/libutil/logwtmp.c,v 1.13 1999/08/28 00:05:50 peter Exp $0123456789invalid hostname%d/var/log/wtmp_HiStOrY_V1_ rw%s 8|h<L,*?_-.[]~=bindtelltcsettcechotcsetty,,,,, l/.editrcHOME%s%sr^DEditline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo all changesvi-undo-lineVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next%d %skey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed key_delete: Null extended-key not allowed. Unbound extended key "%s" Some extended keys too long for internal print buffer "%s..." %-15s-> %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. L$\0<history        T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T h t T T   T T T T T T T  T T T  T  T  T h d  9   t $ *[]?|  $  $                                  \ l sends cursor end@7sends cursor homekhcursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabsptOut of termcap string space. TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. downleftrighthomeend Your terminal has the following characteristics: It has %d columns and %d lines ano It has %s meta key not It can%suse tabs (empty) %25s (%s) == %s yessettc: Bad value `%s'. %s %d tabsmetabaud%lu rowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d). C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C C chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarterase2eol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonocrocrnlonlcropostimaxbelixoffixanyixonicrnligncrinlcristripinpckparmrkignparbrkintignbrk%s: Unknown switch `%c'. %*s%c%s %s %s: Invalid argument `%s'. a :b ?c 8c a lb ?c :b 8c a b ?c $b 0b Hb b ?c ?c xb hb b b b 8c b c ?c ?c 8c $c %d%02d%03dd e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e He e e e e e  e e e e e e e d d e e e e e e e e e e te e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e d e e e e le e e e e e e e e \e  kkkkkkk|kykvkskpkmkjkgkdkak^k[kXkUkRkOkLkIkFkCk@k=k:k7k4k1k.k+k(k%k"kkkkkkkxrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambwllllllllllllll|lylvlslplmljlgldlal^l[lXlUlRlOlLlIlFlCl@l=l:l7l4lkndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitcowwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww~w{wxwuwrwowlwiwfwcw`w]wZwWwTwQwNwKwHwEwBw?wu;u8u5u2u/u,u)u&u#u uuuuuuu uuuuttttttttttttttttttttttttttttttttttttttttttt~t{txtutrtotltitftct`t]tZtWtTtQtNtKtHtEtBt?thardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?f                                                                                                           Can't backspace off beginning of line|xtolifc` ] Z W S NKEB?<83.)#  !"#$ܸٸոҸϸ˸Ƹø     .{wsnie_ZSL DHDA=930-)#  I   ޷۷շϷʷķ !"#$%&'()~*y+t,n-k.g/c0_1;[2LX3S4O5L6H7C8>9b8:2;-<'=!>?@AB CDEFG=HIJKLM۶NնOѶPͶQɶRöST7UiVWQXYZ[\]^!_`ab|c^xdtepflghhdiaj]kYlTmQnMoIpEqAr;s35t1u-v)w%x!yz{|~}~ ݵٵյѵ͵ȵĵ{vqlg6b]XSNIFD?:50+&! PeܴشӴδɴĴ Hzupkgb]XSNI+D?:50+ &!!"#$% &()*+,-./۳0ֳѳ2̳3dz4³56789:<=>?@AB|CwDrm Fh Gc H^ IZ VQOLLHC>83%-)$ !"#$%&'()߲*ٲ+Ӳ,ϲ-ʲ.EŲ/0123456789:;<N=y>u?o@jAfB`C[DpUEOFKGFH@I:J4K5/L)M/"NOPQR STUVWXYZޱ[Xٱ\Ա]α^|ȱ_ñ`ab[cdefWghijkl|mwnmrolpfq`rZsUtMuGvAw8x1yt+z%{|}R~ ްٰѰ̰ǰ°!%&'"# ()$%&|w*r+mhc^YTOJE@<;y61,box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwLLP0ę\X|`(,ppԞ8T̯l4td@l(`Tx̣dԡ htPؠ@ȪL$ХpH$t@ `ܙ, $xl<hШ`М<`<Dxܜ4XȡğX,4p ؚ08؝ԭ  ,hțأhX|H\x̩d8dl8P|$dԛ8P<Ĝ48| dD\d0ĨtT ܥ( 0XhD,Ы دl4<\<tج|x`00ܫةX0ܮLDПܨTĮ<īTX`̚HXHpĥld|̠ܟЮ̬@HT, |lifc` ] Z W  KB?< |!y"v#s$pmٸjҸϸgdø   a ^ [XUROLIFC@=:741.+(% "A       a۷ !"#$%&'(-)*+,-k./0f12X345L6789:;<=>}?z@wAtBqCnDkEhFeGbH_I\JYKVLSMPNMOJPGQDRAS>T;U8V5W2X/Y,Z)[&\##] ^_`abcd efxghijklmnopoqrstuvwxyz{|}~%u~{~xurolifc`]ZWTtQNaKmHEBd? <9v6`30W-*'$!  z.'X(/56789:;<=|>y?v@sApBmDjEgda^[XUROLIFC^@=:741. + ( % "    !"#$%&'()߲*+,-./01234506789:;<=>?@ABCDgEFhGHIJKLMNO}PzQwRtSqTnUkVhWeXbY_Z\[Y\V]S^P_M`JaGbDcAd>e;f8g5h2i/j,k)l&mC#n opUqrstuv wxyz{|}e~fghi!%&'"#()$%&{*+~{xbxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbH8p\|0TL8`h` X0 t,|0lT (8H|<dhL4ld<| $\xT4Lxl<@D@4L$Dt<p <, ` `H@dLD(4H tX|@$DXx(H,hxX P40tXptxXHhl$$dP4xT08LXpp0d(lTDtl 4pt,dDX h,(,\Ld@h<$||p$d<PT,H0\@`hpP(@,ru]VGDZ5Q~qzwztzqznzkzhzzBCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsbic|]wWrQLӴkselkbtabfont3font2font1font0Out of memorystring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</> h h h h h  h T  h  h   h h  h  h h h h h  h h h  h  h h h h h h h h h h h h h h h h h h h h h h h H h h h h  < h  h 0 h h  h h h `  h h h < 4 h P  \  t               \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r < < < < < < < < < < $ $ $ $ $ $ $ $ $ $ < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <   < < < <  < < < < < <  < <  Out of memory.|yvspmjgda^[XUROLIFC@=:741/-+)'%#!   }{ywuspmjgda^[XUROLIFC@=:741.+(%"  ~|zxvtrpnljhfdb`^\ZXVTRP~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' DA=941.+(%" OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwre[N>+~rfXL5*p_G6"return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin3 0 * ' #                                  | OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols+ ! *           z p a Q @ /           | t ` Q : $     number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns|vsplfb]XRMGA<94.)%! {upjd`\XTOKGC?;73/)# ~xtplhd`\XURNKGD@<740-*$  }xsnid_ZUPKFA<72-(# }xsnid_ZUPKFA<72-(# {vplga\VQKFC@=:741.+(%" }wrle`[VQMHB<61+&! {tnhb]XRLF@:3-'! box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbt555555x5p5a5O5@545(55 5444444444{4d4S4C454#444333333}3i3\3K3:3'3332222222222v2l2c2\2U2L2D2<242-2&2222 221111111111111111v1j1c1\1T1M1F1?18111*1#111 11000000000{0l0c0X0N0A08000$000///////////u/f/Y/O/H/A/:/3/,/#// //...........v.l.`.W.L.D.:.1.(... ..-----------}-q-h-_-S-F-<-0-(- -- --,,,,,,,,,,,,x,k,`,U,K,>,4,&,,,,,++++++++++++++++~+v+n+f+^+V+N+F+>+6+.+&+++++****************~*v*h*X*G*:*0*"***))))\V)))))))))))))w)k)Z)J);),)) )(((((((|(k(Q(<(*(('''''''}'g'V'A'6'+'' ''&&&&&&&~&i&S&D&0& & &%%%%%%%%%s%i%X%G%=%1%#%% %$$$$$$$$r$]$N$>$.$$$#######m#Y#G#0####""""""""s"j"a"X"O"E";"2"&"" "box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tabUnmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit| [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [#  [# [# [# T h !  [# [#  [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [#  [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# t  [#  [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [# [#   @!   H# <# H# H# H# H# H#  "  "  "  "  "  "  "  "  " H# H#  H#  <# H# H#  H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H#  H# H# H# H# H# H# H# H# ` H#  H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H# H#  H# H# H# T T Z, ) * ) * @, @, ) Z, Z, Z, Z, + + l+ l+ + + + Z,  , + 8, |* * Z, Z, Z, Z, h1 4 5 @6 @6 6 7 \: ; ; $< T< @@ @@ = h< ? > d@ tA B B  C : 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check\i i Ej tj j j k (k k k  l 6l l l  deflate 1.1.4 Copyright 1995-2002 Jean-loup Gailly 8| } }  }          1.1.4q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatx   \ O  ې  ! X incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.4       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance code0   ^ <     @  inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length code$FreeBSD$$FreeBSD$$FreeBSD$-csh/bin/sh./%s: illegal option -- %c %s: option requires an argument -- %c $FreeBSD$@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%c?%02d%m/%d/%y%2d%Y-%m-%d%03d %H:%M%ld%lu%H:%M:%S %d%04d%e-%b-%Y+-                                                                     (          D   ( \    H  8 \        h   `   h   ( H      @ x  0 0      shut up gcc*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%dxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL          (                                             T `                                 [:<:]][:>:]]+ h+ + , d, , - T- - - P. . 2 2 2 2 \4 \4 \4 \4 \4 g4 d3 3 \4 \4 \4 \4 \4 \4  4 84 RSHtcpshell%drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s %s: %s connect to address %s: Trying %s... rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerISO_ISOEUCja_JPeucJPko_KReucKRzh_CNeucCNASCIIUS-ASCIICPOSIXU PW dW xW W W W W W W W W W W W W W W W W W W W W W W W W W W W W W X X X X X X X X X X X X 0Y 0Y 0Y 0Y 0Y X  X (X 8X HX XX hX  Y 0%X%X[  \  \  \  \  \  \ [ [ [ [ [ [ [  \  \  \  \  \  \  \  \  \  \  \  \  \  \  \  \  \  \ [ $FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18 2000/06/17 11:09:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %mhhhhhhhhhhhhhhhhhhh}hxhshnhkhfhahZhUhOhJhEh@husr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 0hFk;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6insecure1insecure2no_tld_queryedns0ȉĉȉĉȉĉtcpudpUnknown errorResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAIgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"# 0/etc/hosts;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; rcode = %u, ancount=%u h x X H x x ;; res_querydomain(%s, %s) %s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/;; res options: %s;; ns_parserr: %s ;; %s SECTION: .;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %d930)% NONEANYHESIODHSCHAOSINxADDITIONALAUTHORITYANSWERQUERYߏ؏xUPDATEPREREQUISITEZONEicTP=:2/    ɔ rnifSM;7+& ޓۓǓ“~qmd`@$ ߒ!"zu[VHB #%"any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2noaliasesinet6no-tld-queryedns0?0x%lx?%u%ld.%.2ld t t t t t t t t  t t t t < t t t < t t t t t t t t t t t t t  t t t t t t t t  t t t t < t t t <                                                    ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ;     p        4   4     x   $     @     0 " "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d ( ( (  ( ( ( (  ( ( ( ( (  ( ( (  %d%cnisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:;$FreeBSD$ hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) static buffer is too small (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpaip6.intres_query failed (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD$$FreeBSD$$FreeBSD$$FreeBSD$SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_all: clnt_callyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d t0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 $FreeBSD$clntudp_create: out of memory T= l= = = = = > <= H= = > > 4> L> d> > > > |> > clnttcp_create: out of memory hD D D nE nE D nE PD \D D D E E ,E @E nE nE nE TE %s: %s; errno = %s ; low version = %lu, high version = %lu ; why = %s (unknown authentication error - %d) ; s1 = %lu, s2 = %lu J  J  J lI lI  J I I  J I  J  J  J  J  J  J  J  J u\H1"զ`G5RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s oW># Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKGMT/etc/localtime/usr/share/zoneinfo/mnposixrulesTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d :                                                            01234567890123456789abcdef0123456789ABCDEF[inet_ntoa error]$FreeBSD$0123456789Unknown error: $FreeBSD$$FreeBSD$xdr_reference: out of memory xdrrec_create: out of memory      %u.%u.%u.%u%x$FreeBSD$$FreeBSD$xdr_bytes: out of memory xdr_string: out of memory  N.LC_NUMERICNNNNNNNNNNNNNNNLC_MONETARYCPOSIX/union/usr/bin:/bin:/usr/sbin:/sbin:                   %$sniglet^&TMPDIR/tmp%s/bt.XXXXXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzC!/dev/urandomq^K8%(((((((((p)q*)q*q* *)q* *mpool_new: page allocation overflow. InfNaN0123456789abcdef(null)0123456789ABCDEF0BRRBRRRRRRBCRCCRxEEEEEEEEEERRRRRRRRRRFGRGRRRRFRRKRRRRR`NRRORRRRRRRRRRPFFGGGFFRR FRJK8MDFRMRgNRRO ] b b ] b b b b b b(] ] b ]] b ]H^H^H^H^H^H^H^H^H^ b b b b b b b b b b^|_ b|_ b b b bx^ b b` b b b b b` b bHa b b b b b b b b b bL_^|_|_|_^^ b b^ b_``^ ba b` b bHabbbbbbbbbbtbbbbbbb$FreeBSD$@?5?55?5?InfinityNaN0?aCoc?`(?yPD?$@@@?ȃȃ  error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits ||||||||||̛| |||||||||(@|X|p||||||||||||||||||||ܛ||4|L|djunk pointer, too low to make sense junk pointer, too high to make sense modified (page-) pointer modified (chunk-) pointer chunk is already free pointer to wrong page page is already free freelist is destroyed malloc() has never been called in malloc():recursive call out of memory in free(): in realloc():No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error?res_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() kqueue;; Querying server (# %d) address = %s socket(vc)connect/vcwrite failedread failed;; response truncated ;; undersized: %d read(vc);; old answer (unexpected): socket(dg)connect(dg)sendsendtos out-of-boundskevent;; timeout recvfrom;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: TҼ4$:Ҽ:r0Ll@THASH: Out of overflow pages. Increase page size ,,,, , Rp|Xyxvs,nid8a^(XURl%L2F4A5; 65 60;&> Pk`oxx#$`=IO!,@Ȃ@Bʚ;Ƥ~@P.P@FFFFFFFFFFFFFFjGeG[GQGHGAG2G+G%GGFGG GG/tmp/EdDk.XXXXXXXXXXxm\]]]]___ _!_"_#__n_h_[_@_ _^ ^ ^^^^@^P^Q^Rx^Vu^ao^c@^d^e^u]@]@mmmmmmm@m mmm m@mmzm mmnnn ppsysvsssnshsds_sWsRsHs@As;s 2s@)s#s@sss##.|toe@^X O@F@;4)@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. ޵ٵѵ̵µ@ @w۸ٸӸٸ̸ʸĸ¸\send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingtoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecounttoggle restriction of data port rangeremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modepxyRQcQx \|`4i w4y |Ohij8m4ydx$P64Lk/4n*-4h]$@t 4nR8 8   T  T `8m}| 8Fpge e`TzR tx vDY@(Ylwxqixk@|ucgԇ[VRMeHvCc<|_5`R-؂&8 Q@d1O`x recUmg^WOG @haC'@ fb@!h)h)4'T't''u@`=!4**q+l@*|% ~)`OI?)  @x@܁`` ,,,,a~eMC ܠ OO_`XD YbPOOSa@U"^ZVa@T\]QQb3T3` @4@4X4@4@4X4k@4a@4WX4O1@4(@4X4p43p4H  ́́0;0;`L?A ?H`@@iL@G  A(<(<connect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to OPIE challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)T:;5`4CCD:i`$. 1!A -`;809 <:Q"deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' insteadQa 7%D8""""D?;)$ {m_TE>2*%~ytnhb]YUPK(standard output)/etc/gettytab@ , H5(p.,(.#(.(/(TgTU@TTXTSYSS;SSZ`SJS= SSBRRARmRRRRCRQ,RRMQQNQhQC@Q,QHQPVPPWP`PK PPLOO'`OGO& OO5NN,NxN-@N0N%NM)MM0`MC"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""JBp\BA 8\OB@> VBP? cB(O ? fwdbck:*aaaaa````````````y`v`f`c`S`P`8`5`)`&````_____________{_x_b___R_O_@_=_'_$_____^^^^^^^^^^^}^g^d^Q^N^<^9^(^aa~anakaYaVaIaFa0a-aIa[1~[4~OAOBOCOD+c/cee@eeee@e@ee eae@eeee = =,A"'B" """"gggggzg tg@nghgcg]gWgOg IgCg=g7g 0g)g@#gggggg f@ffffffffffff@f@f fff xfmfcf[fVfQfKfFfBf>f 9f@2f,f'f ff f@ ffeeee@(#)tokenizer.c 8.1 (Berkeley) 6/4/93| | `%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+o7T787776666666`6 655xD%FFFFFEEEEFG@F LF@G `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`?? W$FreeBSD$\\\\\\\g\[\D\8\\\[[[ [[ [[ [h[ ][O[ D[ [[ZZZZZbZ@Zc]]]W]Q]K]E]?]9]3]-] '] ] V`R`N`J`F`B`>`:`4`1`'`$` ` ` ` ` ` ` _ _ _ ______________________-] _!t_"h_#\_$O_%E_&:_')_(_)_*_+^,^-^-^.^.^/^/^0^1^2^3^4^5^6^7^8^9^:^;z^<n^=\^>N^?@^@,^["^\^\]]]^]^]_]_]`]{]{]|]}s]}m]~i]gg~gsglgbgUgLgBg9g/g(ggg ggffq u @(#)getbsize.c 8.1 (Berkeley) 6/4/93wwwwwwwwwwwwwwCx>x4x*x!xx xxwwwwwww$OpenBSD: dirname.c,v 1.4 1999/05/30 17:10:30 espie Exp $Ի ܻ    zzzztzlz`zCCCCCCC  l Dm [ ^  k@`? ډ̉ء   d'@Bʚ;ʘØ.& ܘ٘ИOA6$FreeBSD$$FreeBSD$x   @ $FreeBSD: src/lib/libc/net/base64.c,v 1.3 1999/08/28 00:00:03 peter Exp $$FreeBSD$tjc^ZSPD@  `d6 = < < > = tA $D C C |E ,D N TN N N N @(#)localtime.c 7.57WILDABBRAA@(#)asctime.c 7.7$FreeBSD$$FreeBSD$0123456789L     \ ܖ 0  Ț X  Л     ( X  Л  0    RuneMagiNONE , BBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~`B 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ